(data stored in ACNUC1104 zone)

EMBL: CP002026.PE430

CP002026.PE430       Location/Qualifiers
FT   CDS             complement(443324..444001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0434"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   oan:Oant_1851 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87767"
FT                   /db_xref="GOA:D7A349"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D7A349"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH87767.1"
FT                   /translation="MEAIAADLAAFMRGHEYLVPVVIGLIAFAESLVLVGLVVPATALM
FT                   LAIGGLIGSGILSPVPVISGAIVGAALGDIVSYWLGRWVGPRVVHRWPLQGYRHQVAQA
FT                   RLFFRRFGFASVFVGRFFGPVRATMPLVAGMMRMDQRRFQFANVSSAIVWAPVMLAPGW
FT                   IAGKGANQLGAASSGEWLVLMVGITLVMLIATAVILRVVQGRIAKRPRNRRAARTSARA
FT                   SAG"
     MEAIAADLAA FMRGHEYLVP VVIGLIAFAE SLVLVGLVVP ATALMLAIGG LIGSGILSPV        60
     PVISGAIVGA ALGDIVSYWL GRWVGPRVVH RWPLQGYRHQ VAQARLFFRR FGFASVFVGR       120
     FFGPVRATMP LVAGMMRMDQ RRFQFANVSS AIVWAPVMLA PGWIAGKGAN QLGAASSGEW       180
     LVLMVGITLV MLIATAVILR VVQGRIAKRP RNRRAARTSA RASAG                       225
//

If you have problems or comments...

PBIL Back to PBIL home page