(data stored in ACNUC1104 zone)

EMBL: CP002026.PE433

CP002026.PE433       Location/Qualifiers
FT   CDS             447142..448122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0437"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   msl:Msil_0234 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87770"
FT                   /db_xref="GOA:D7A352"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A352"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADH87770.1"
FT                   /translation="MLSRLLRHPVTLIVGVVVALFVIYEISVRFFAYTADAYVMSDIVV
FT                   ISSQIEGPVSKLAVQNNQTVAANQLLFEIERTPFALKVQEAQASLAQAQANLGLAQDEV
FT                   NAAKANIASAQAIQANAQEQLNRIKTLSGEGFSPEAQLDVATRDVATAGANVSSTQAQL
FT                   AVATQRVTVANAAIGSTQAELARAEYDLSKTVVAAPEAGRITPFTTRLGDYLRPGTEVL
FT                   AIITDRRRRVVANMNERHLERIRIGQRVLLTLGNDPWQLHLGRVSGIAAGVARSPHNPE
FT                   IVPYVEPTTDWVRLPRRFPIEIELDDWPAGVGLFNGADARVLIWF"
     MLSRLLRHPV TLIVGVVVAL FVIYEISVRF FAYTADAYVM SDIVVISSQI EGPVSKLAVQ        60
     NNQTVAANQL LFEIERTPFA LKVQEAQASL AQAQANLGLA QDEVNAAKAN IASAQAIQAN       120
     AQEQLNRIKT LSGEGFSPEA QLDVATRDVA TAGANVSSTQ AQLAVATQRV TVANAAIGST       180
     QAELARAEYD LSKTVVAAPE AGRITPFTTR LGDYLRPGTE VLAIITDRRR RVVANMNERH       240
     LERIRIGQRV LLTLGNDPWQ LHLGRVSGIA AGVARSPHNP EIVPYVEPTT DWVRLPRRFP       300
     IEIELDDWPA GVGLFNGADA RVLIWF                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page