(data stored in ACNUC1104 zone)

EMBL: CP002026.PE437

CP002026.PE437       Location/Qualifiers
FT   CDS             complement(452938..454239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0441"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: xau:Xaut_0320 RND family efflux transporter
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87774"
FT                   /db_xref="GOA:D7A356"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A356"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87774.1"
FT                   /translation="MSNDNLGNDAGSSQIVHVEIARDVASQHKRHRWREAGVVLTLAAL
FT                   ATGAAVFLAWPSSNALATDPAPAAAAPPAMPVAVAVLEPRDTMKWDEFSGRLQAVERVE
FT                   VRPRVAGAVKTIHFREGALVKQGELLVTIDPEPFQAELDRAEAQSAAAEARLLFTKNEL
FT                   DRGQKLVDSRVVSVQDLDQRTNNYKEAQANLRAAQADVQTAKLDLGYTEVRAPVDGRVG
FT                   RIDVTVGNLVSAGPTSPVLTTLVSVDPIYVGFAADEGAVSEALATLGNGDVLGEIDRIP
FT                   VEITTATTGEKPARGHLQLVDNQVDTATGTFRLRAVFDNPDGRLVPGQFARVRMGRAKT
FT                   EPALVINERAIGTDQDKKYVFVVDPENKAVYREVKLGPPSEGLRVVASGLKEGERIVVN
FT                   GLQRVRPGALLAPEIVPMNTTASAANPNTSVAAR"
     MSNDNLGNDA GSSQIVHVEI ARDVASQHKR HRWREAGVVL TLAALATGAA VFLAWPSSNA        60
     LATDPAPAAA APPAMPVAVA VLEPRDTMKW DEFSGRLQAV ERVEVRPRVA GAVKTIHFRE       120
     GALVKQGELL VTIDPEPFQA ELDRAEAQSA AAEARLLFTK NELDRGQKLV DSRVVSVQDL       180
     DQRTNNYKEA QANLRAAQAD VQTAKLDLGY TEVRAPVDGR VGRIDVTVGN LVSAGPTSPV       240
     LTTLVSVDPI YVGFAADEGA VSEALATLGN GDVLGEIDRI PVEITTATTG EKPARGHLQL       300
     VDNQVDTATG TFRLRAVFDN PDGRLVPGQF ARVRMGRAKT EPALVINERA IGTDQDKKYV       360
     FVVDPENKAV YREVKLGPPS EGLRVVASGL KEGERIVVNG LQRVRPGALL APEIVPMNTT       420
     ASAANPNTSV AAR                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page