(data stored in ACNUC1104 zone)

EMBL: CP002026.PE438

CP002026.PE438       Location/Qualifiers
FT   CDS             complement(454256..455092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0442"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: xau:Xaut_0321 alpha/beta hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87775"
FT                   /db_xref="GOA:D7A357"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A357"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ADH87775.1"
FT                   /translation="MTALWTEDRLEMDGTALPVRVYRAAASMRPTPLVLHLHGGCFTDG
FT                   DLECSVKVCQLMAEAGAVVVSADYPLAPEHPFPAALNVSFAALGLLHAQRAKWAGRGSR
FT                   LFVAGEEAGANLAAALAMMARDQGAPAVAGQILLSPMIDPSLCTGSIHAAEAGAAGCKW
FT                   ADGWHRYLGSADKAAHPYAAPFGSRRLAGVAPALIITCSDCPMRDESLAYARRLAESGI
FT                   AVETSVLETPADSPDEIDASMDASIDASPQWEAPLRDLFQNFLAEHSASPVRTIRA"
     MTALWTEDRL EMDGTALPVR VYRAAASMRP TPLVLHLHGG CFTDGDLECS VKVCQLMAEA        60
     GAVVVSADYP LAPEHPFPAA LNVSFAALGL LHAQRAKWAG RGSRLFVAGE EAGANLAAAL       120
     AMMARDQGAP AVAGQILLSP MIDPSLCTGS IHAAEAGAAG CKWADGWHRY LGSADKAAHP       180
     YAAPFGSRRL AGVAPALIIT CSDCPMRDES LAYARRLAES GIAVETSVLE TPADSPDEID       240
     ASMDASIDAS PQWEAPLRDL FQNFLAEHSA SPVRTIRA                               278
//

If you have problems or comments...

PBIL Back to PBIL home page