(data stored in ACNUC1104 zone)

EMBL: CP002026.PE439

CP002026.PE439       Location/Qualifiers
FT   CDS             455247..456176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0443"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mpt:Mpe_A0871 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87776"
FT                   /db_xref="GOA:D7A358"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A358"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87776.1"
FT                   /translation="MDQIAAMRAFVRVVEAGNFSRAADLLEMPKPTITKLIQQLESHLR
FT                   TKLLNRTTRRVGVTPDGAAYYERALALLSDLDELDGSMTKAQTTPSGRLRVDVGSSLAL
FT                   NVLIPALPDFHARYPDIQLDLGVSDRPADLVGENIDCAIRGGELLDPSLIARRIGQVEL
FT                   VMCATPGYIQRHGMPQHPRDLRDGHRVIAYFSPRTGRRFAFDMIRGEETYELDLPYAVA
FT                   VNDSTAYLAACLTGLGIAHAVEPMIQPYLAAGTLVPVLPEWRGEPIVLHVVYAPNRHLS
FT                   SRLRVFVDWVAELFASGNVYRRRPEALF"
     MDQIAAMRAF VRVVEAGNFS RAADLLEMPK PTITKLIQQL ESHLRTKLLN RTTRRVGVTP        60
     DGAAYYERAL ALLSDLDELD GSMTKAQTTP SGRLRVDVGS SLALNVLIPA LPDFHARYPD       120
     IQLDLGVSDR PADLVGENID CAIRGGELLD PSLIARRIGQ VELVMCATPG YIQRHGMPQH       180
     PRDLRDGHRV IAYFSPRTGR RFAFDMIRGE ETYELDLPYA VAVNDSTAYL AACLTGLGIA       240
     HAVEPMIQPY LAAGTLVPVL PEWRGEPIVL HVVYAPNRHL SSRLRVFVDW VAELFASGNV       300
     YRRRPEALF                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page