(data stored in ACNUC1104 zone)

EMBL: CP002026.PE44

CP002026.PE44        Location/Qualifiers
FT   CDS             complement(33874..34557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0044"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   bja:blr6107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87381"
FT                   /db_xref="GOA:D6ZZW7"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW7"
FT                   /inference="protein motif:PFAM:PF02586"
FT                   /protein_id="ADH87381.1"
FT                   /translation="MCNLYSHHSNVEAIRDLVGTLRNLAGNLAPQTGIFPDYPAPIVRT
FT                   GADGERELAMARWGMPSPPQFGGPPVTNIRNVASPHWRRWTGPASRCLVPMTSFSEYAP
FT                   EPNPVTKRKDVVWFALSEERPLTFFAGIWTPWDGVRGTKANPVLGPHDLYGFLTCEPNA
FT                   VVKPIHPKAMPVILTTAEEREVWMRAPWSEACALQRPLADDGLTIVARGAAKEDPPVED
FT                   LRLLV"
     MCNLYSHHSN VEAIRDLVGT LRNLAGNLAP QTGIFPDYPA PIVRTGADGE RELAMARWGM        60
     PSPPQFGGPP VTNIRNVASP HWRRWTGPAS RCLVPMTSFS EYAPEPNPVT KRKDVVWFAL       120
     SEERPLTFFA GIWTPWDGVR GTKANPVLGP HDLYGFLTCE PNAVVKPIHP KAMPVILTTA       180
     EEREVWMRAP WSEACALQRP LADDGLTIVA RGAAKEDPPV EDLRLLV                     227
//

If you have problems or comments...

PBIL Back to PBIL home page