(data stored in ACNUC1104 zone)

EMBL: CP002026.PE440

CP002026.PE440       Location/Qualifiers
FT   CDS             complement(456180..456908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0444"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ara:Arad_2946 amino acid ABC transporter;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87777"
FT                   /db_xref="GOA:D7A359"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A359"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87777.1"
FT                   /translation="MSLIEITEVKKRFGDNEVLKGINIDVAPGEVIAIIGKSGSGKSTL
FT                   LRCINGLETIDEGSISVAGAQLLPDELHLKALRLKVGMIFQSFNLFPHLTAGRNVMLSQ
FT                   MVVKKTAKAEAEAMARRQLERVGLGHKFDAYPDQLSGGQQQRIAIARALAMQPIALLCD
FT                   EITSALDPELVSEVLAVVKELAGEGMTLMMVTHEMRFARDVCSRVVFMHQGRVHEIGPP
FT                   EEVFAAPKTPELKQFLGVLH"
     MSLIEITEVK KRFGDNEVLK GINIDVAPGE VIAIIGKSGS GKSTLLRCIN GLETIDEGSI        60
     SVAGAQLLPD ELHLKALRLK VGMIFQSFNL FPHLTAGRNV MLSQMVVKKT AKAEAEAMAR       120
     RQLERVGLGH KFDAYPDQLS GGQQQRIAIA RALAMQPIAL LCDEITSALD PELVSEVLAV       180
     VKELAGEGMT LMMVTHEMRF ARDVCSRVVF MHQGRVHEIG PPEEVFAAPK TPELKQFLGV       240
     LH                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page