(data stored in ACNUC1104 zone)

EMBL: CP002026.PE445

CP002026.PE445       Location/Qualifiers
FT   CDS             complement(460216..462384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0449"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   KEGG: azc:AZC_1772 methylmalonyl-CoA mutase; PFAM:
FT                   methylmalonyl-CoA mutase; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87782"
FT                   /db_xref="GOA:D7A364"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7A364"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ADH87782.1"
FT                   /translation="MTATARRIPDFSAIDWKAPALALPPEGAGAWETPERIAVKPLYGP
FT                   DDVAGLAFVDSYPGIAPFLRGPYPTMYATQPWTIRQYAGFSTAEDSNAFYRRNLAAGQK
FT                   GLSVAFDLATHRGYDSDHPRVAGDVGMAGVAIDSILDMRTLFSGIPLDRMSVSMTMNGA
FT                   VLPILALYVVAAEEQGVKPAQLSGTIQNDILKEFMVRNTYIYPPGPSMRIIADIFAFTA
FT                   KEMPRFNSISISGYHMQEAGATQDLELAYTLADGVDYVRAGIAAGMPVDAFAPRLSFFW
FT                   AIGMNFFMEVAKLRAARLIWAKLMKDLGASNPKSLPLRTHCQTSGWSLTAQDVFNNVMR
FT                   TMVEAMAATQGHTQSLHTNALDEALALPTDFSARIARNTQLLIQQESGTTRAIDPWGGS
FT                   FYVERLTADLAQKALGHIAEVEALGGMAKAIEAGIPKLRIEEAAAITQARIDSGAQTVV
FT                   GVNKYRPTREMLIDVLKVDNSAVRAAQLDKLRRLKAERDPQAVEAALAALENGARGNAN
FT                   LLALAIDAARAKATVGEISDALERVFGRHRAEIRAVTGVYRREAGAMGDRVARMRQRIE
FT                   AFEHEEGRRPRILVAKVGQDGHDRGQKVIASAFADLGFDVDIGPLFATPQEAARQAVEN
FT                   DVHVIGISSLAAGHLTLVPQVKAALAAEGRPDIMVVVGGVVPPQDYEAVRAAGAEAIYP
FT                   PGTVIAEAAEELVDKLAARLGHKKQAAE"
     MTATARRIPD FSAIDWKAPA LALPPEGAGA WETPERIAVK PLYGPDDVAG LAFVDSYPGI        60
     APFLRGPYPT MYATQPWTIR QYAGFSTAED SNAFYRRNLA AGQKGLSVAF DLATHRGYDS       120
     DHPRVAGDVG MAGVAIDSIL DMRTLFSGIP LDRMSVSMTM NGAVLPILAL YVVAAEEQGV       180
     KPAQLSGTIQ NDILKEFMVR NTYIYPPGPS MRIIADIFAF TAKEMPRFNS ISISGYHMQE       240
     AGATQDLELA YTLADGVDYV RAGIAAGMPV DAFAPRLSFF WAIGMNFFME VAKLRAARLI       300
     WAKLMKDLGA SNPKSLPLRT HCQTSGWSLT AQDVFNNVMR TMVEAMAATQ GHTQSLHTNA       360
     LDEALALPTD FSARIARNTQ LLIQQESGTT RAIDPWGGSF YVERLTADLA QKALGHIAEV       420
     EALGGMAKAI EAGIPKLRIE EAAAITQARI DSGAQTVVGV NKYRPTREML IDVLKVDNSA       480
     VRAAQLDKLR RLKAERDPQA VEAALAALEN GARGNANLLA LAIDAARAKA TVGEISDALE       540
     RVFGRHRAEI RAVTGVYRRE AGAMGDRVAR MRQRIEAFEH EEGRRPRILV AKVGQDGHDR       600
     GQKVIASAFA DLGFDVDIGP LFATPQEAAR QAVENDVHVI GISSLAAGHL TLVPQVKAAL       660
     AAEGRPDIMV VVGGVVPPQD YEAVRAAGAE AIYPPGTVIA EAAEELVDKL AARLGHKKQA       720
     AE                                                                      722
//

If you have problems or comments...

PBIL Back to PBIL home page