(data stored in ACNUC1104 zone)

EMBL: CP002026.PE448

CP002026.PE448       Location/Qualifiers
FT   CDS             complement(466285..467817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0452"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: azc:AZC_1775
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87785"
FT                   /db_xref="GOA:D7A367"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D7A367"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADH87785.1"
FT                   /translation="MKHILDELEQRRAGARLGGGEKRIEAQHRRGKLTARERIELLLDT
FT                   GSFEEFDSFVQHRCTDFGMEKSKIPGDGVVTGWGTVNGRQVFVFAKDFTVFGGSLSEAH
FT                   AAKITKIQDLALKTRAPIIGLFDAGGARIQEGVAALGGYGEVFKRNVLASGVIPQISVI
FT                   MGPCAGGDVYSPAMTDFIFMVRDTSYMFVTGPDVVKTVTNETVTSDELGGAKVHTTRSS
FT                   VADGAYDNDVECLLQMRRLIDFLPENNLSGVPSWPSFDDGERIDASLDTLVPDNPNKPY
FT                   DMKELIGKVVDEGDFFEIQEAFARNIVTGFGRVEGRTVGIVANQPMVLAGVLDADASRK
FT                   AARFVRFCDAFEIPILTFVDVPGFLPGTAQEYGGLIKHGAKLLFAYSQATVPLVTLITR
FT                   KAFGGAYDVMASKHIGGDVNYAWPTAQIAVMGAKGAVEIIFRADIDDPEKIAARTKEYE
FT                   QRFLSPFVAAERGYIDEVITPRSTRKRIARALAMLASKRIEAPMKKHDNLPL"
     MKHILDELEQ RRAGARLGGG EKRIEAQHRR GKLTARERIE LLLDTGSFEE FDSFVQHRCT        60
     DFGMEKSKIP GDGVVTGWGT VNGRQVFVFA KDFTVFGGSL SEAHAAKITK IQDLALKTRA       120
     PIIGLFDAGG ARIQEGVAAL GGYGEVFKRN VLASGVIPQI SVIMGPCAGG DVYSPAMTDF       180
     IFMVRDTSYM FVTGPDVVKT VTNETVTSDE LGGAKVHTTR SSVADGAYDN DVECLLQMRR       240
     LIDFLPENNL SGVPSWPSFD DGERIDASLD TLVPDNPNKP YDMKELIGKV VDEGDFFEIQ       300
     EAFARNIVTG FGRVEGRTVG IVANQPMVLA GVLDADASRK AARFVRFCDA FEIPILTFVD       360
     VPGFLPGTAQ EYGGLIKHGA KLLFAYSQAT VPLVTLITRK AFGGAYDVMA SKHIGGDVNY       420
     AWPTAQIAVM GAKGAVEIIF RADIDDPEKI AARTKEYEQR FLSPFVAAER GYIDEVITPR       480
     STRKRIARAL AMLASKRIEA PMKKHDNLPL                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page