(data stored in ACNUC1104 zone)

EMBL: CP002026.PE452

CP002026.PE452       Location/Qualifiers
FT   CDS             complement(471499..472836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0456"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   msl:Msil_2634 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87789"
FT                   /db_xref="GOA:D7A371"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A371"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADH87789.1"
FT                   /translation="MSDHSNIPRTKPRASATFDDYTLSEIRRAAATGIYDIRGAGAKRK
FT                   VPHFDDLLFLGASMSRYPLEGYREKCSTEVVLGTRFAKKPIELKIPITIAGMSFGSLSA
FT                   NAKEALGRGASAMGTSTTTGDGGMTNEERGHSIQLVYQYLPSRYGMNPDDLKRADAIEV
FT                   VVGQGAKPGGGGMLLGQKITERVAAMRTLPVGIDQRSACRHPDWTGPDDLEIKIEELRE
FT                   ITDWEKPIYVKVGAARPYYDTALAVKSGADVVVVDGMQGGTAATQEIFIEHVGIPTLAA
FT                   VRQAVKALQDLGMHRKVQLIVSGGIRNGADVAKALALGADAVAIGTAALVALGDNDPHY
FT                   QAEYEALGTTAGAYDDWHEGRDPAGITTQDPALMARLDPVAAGRRLANYLAVLTLECQT
FT                   IARACGKSHVHNLEPEDLVALTIEAAAMAQVPLAGTDWVPGRNGSF"
     MSDHSNIPRT KPRASATFDD YTLSEIRRAA ATGIYDIRGA GAKRKVPHFD DLLFLGASMS        60
     RYPLEGYREK CSTEVVLGTR FAKKPIELKI PITIAGMSFG SLSANAKEAL GRGASAMGTS       120
     TTTGDGGMTN EERGHSIQLV YQYLPSRYGM NPDDLKRADA IEVVVGQGAK PGGGGMLLGQ       180
     KITERVAAMR TLPVGIDQRS ACRHPDWTGP DDLEIKIEEL REITDWEKPI YVKVGAARPY       240
     YDTALAVKSG ADVVVVDGMQ GGTAATQEIF IEHVGIPTLA AVRQAVKALQ DLGMHRKVQL       300
     IVSGGIRNGA DVAKALALGA DAVAIGTAAL VALGDNDPHY QAEYEALGTT AGAYDDWHEG       360
     RDPAGITTQD PALMARLDPV AAGRRLANYL AVLTLECQTI ARACGKSHVH NLEPEDLVAL       420
     TIEAAAMAQV PLAGTDWVPG RNGSF                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page