(data stored in ACNUC1104 zone)

EMBL: CP002026.PE456

CP002026.PE456       Location/Qualifiers
FT   CDS             475511..476905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0460"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: msl:Msil_3303
FT                   soluble pyridine nucleotide transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87793"
FT                   /db_xref="GOA:D7A375"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A375"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87793.1"
FT                   /translation="MYDYDMIVIGSGPSGRRAAVQSAKIGKSVLVIEKGRRVGGVSVHT
FT                   GTIPSKTLRETVLNLSGWRERGFYGRAYRVKQDIGAGDLMARLHKTLDHEVEVLEHQFA
FT                   RNGVKNARGEARFLDPHTIEITGETGEIETVTGEHVLIAVGTKPFRPDYVPFNGMTVFD
FT                   SDEIVDLPKLPRSLAVIGAGVIGVEYATIFSALDVAVTLIEPRTSFLDFIDKELIEEFT
FT                   HELRDRNVGLRLGAAVTSITLGPDERPVCKLADGRTVQADMLLFAAGRVGATDRLNLDA
FT                   AGLNVDHRGRLKVDPKTLQTEVPHIYAAGDVIGFPSLASTSMEQGRVAACHAFGLEPPP
FT                   PPEFFPYGIYSVPEMSTVGMSEEEVRKREIPYECGIARFRETSRGHIMGLSNGMMKMIF
FT                   SVKTRRLLGVHIVGEGATELIHIGQAVLNLKGTIDYFIENTFNYPTLAEAYKIAGLDAW
FT                   NRMPRV"
     MYDYDMIVIG SGPSGRRAAV QSAKIGKSVL VIEKGRRVGG VSVHTGTIPS KTLRETVLNL        60
     SGWRERGFYG RAYRVKQDIG AGDLMARLHK TLDHEVEVLE HQFARNGVKN ARGEARFLDP       120
     HTIEITGETG EIETVTGEHV LIAVGTKPFR PDYVPFNGMT VFDSDEIVDL PKLPRSLAVI       180
     GAGVIGVEYA TIFSALDVAV TLIEPRTSFL DFIDKELIEE FTHELRDRNV GLRLGAAVTS       240
     ITLGPDERPV CKLADGRTVQ ADMLLFAAGR VGATDRLNLD AAGLNVDHRG RLKVDPKTLQ       300
     TEVPHIYAAG DVIGFPSLAS TSMEQGRVAA CHAFGLEPPP PPEFFPYGIY SVPEMSTVGM       360
     SEEEVRKREI PYECGIARFR ETSRGHIMGL SNGMMKMIFS VKTRRLLGVH IVGEGATELI       420
     HIGQAVLNLK GTIDYFIENT FNYPTLAEAY KIAGLDAWNR MPRV                        464
//

If you have problems or comments...

PBIL Back to PBIL home page