(data stored in ACNUC1104 zone)

EMBL: CP002026.PE458

CP002026.PE458       Location/Qualifiers
FT   CDS             complement(477786..478655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0462"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="KEGG: xau:Xaut_4704 formyltetrahydrofolate
FT                   deformylase; TIGRFAM: formyltetrahydrofolate deformylase;
FT                   PFAM: formyl transferase domain protein; amino acid-binding
FT                   ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87795"
FT                   /db_xref="GOA:D7A377"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:D7A377"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ADH87795.1"
FT                   /translation="MTDMTEPYVLTLSCPDRPGIVAAVASFLFERGGNILEAQQFDDTE
FT                   SGRFFMRVVFDRAADSGAIAELKAEFEAVAEKFALNWRLRGRNQKRRVMLLVSKFDHCL
FT                   ADLLYRWRIGEIPMEIAGIIANYPRETYAHLDFADIPFHYLPVTKQTKMEQEAQLWELF
FT                   QKSGAEVAVLARYMQVLSDGLSAKLSGRCINIHHSFLPGFKGAKPYHQAHERGVKLIGA
FT                   TAHYVTSDLDEGPIIEQDVERISHQDTADDLVRKGRDIERRVLARALAWHLDDRVLLNG
FT                   HRTVVFRD"
     MTDMTEPYVL TLSCPDRPGI VAAVASFLFE RGGNILEAQQ FDDTESGRFF MRVVFDRAAD        60
     SGAIAELKAE FEAVAEKFAL NWRLRGRNQK RRVMLLVSKF DHCLADLLYR WRIGEIPMEI       120
     AGIIANYPRE TYAHLDFADI PFHYLPVTKQ TKMEQEAQLW ELFQKSGAEV AVLARYMQVL       180
     SDGLSAKLSG RCINIHHSFL PGFKGAKPYH QAHERGVKLI GATAHYVTSD LDEGPIIEQD       240
     VERISHQDTA DDLVRKGRDI ERRVLARALA WHLDDRVLLN GHRTVVFRD                   289
//

If you have problems or comments...

PBIL Back to PBIL home page