(data stored in ACNUC1104 zone)

EMBL: CP002026.PE462

CP002026.PE462       Location/Qualifiers
FT   CDS             complement(482610..483860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0466"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="KEGG: azc:AZC_1496 sarcosine oxidase beta subunit;
FT                   TIGRFAM: sarcosine oxidase, beta subunit family; PFAM: FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87799"
FT                   /db_xref="GOA:D7A381"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A381"
FT                   /inference="protein motif:TFAM:TIGR01373"
FT                   /protein_id="ADH87799.1"
FT                   /translation="MHYSWLSILKNGLTGQKGWTPAWRDAAPKPSYDVIIVGGGGHGLA
FT                   TAYYLAKVHGIHNVAVIEKGYIGSGNAGRNTTIIRSNYLLPGNEPFYEWSMKLWEGLEQ
FT                   ELNYNAMVSQRGILNLFHSDAQRDAYARRGNAMRLAGADSELLDQRQVRAMYPFLDFDN
FT                   TRFPVQGGLLQRRGGTARHDAVVWGYARAADRLGVDIIQNCEVTGFLREGEAIVGVETS
FT                   RGPIRSAKVGLAVAGSSSRVAQKAGLRLPIESHVLQAFVSEGLKPLIDGVITFGAGHFY
FT                   ISQSDKGGLVFGGDIDGYNSYAQRGNLPVIEDVAESGMALMPRIGRLRLLRMWGGIMDM
FT                   SMDGSPIIDRAPVPGLYLNAGWCYGGFKATPASGWCFAHLLAKDEFHDVGGAYRLDRFR
FT                   TGHLIDEKGVGAQPNLH"
     MHYSWLSILK NGLTGQKGWT PAWRDAAPKP SYDVIIVGGG GHGLATAYYL AKVHGIHNVA        60
     VIEKGYIGSG NAGRNTTIIR SNYLLPGNEP FYEWSMKLWE GLEQELNYNA MVSQRGILNL       120
     FHSDAQRDAY ARRGNAMRLA GADSELLDQR QVRAMYPFLD FDNTRFPVQG GLLQRRGGTA       180
     RHDAVVWGYA RAADRLGVDI IQNCEVTGFL REGEAIVGVE TSRGPIRSAK VGLAVAGSSS       240
     RVAQKAGLRL PIESHVLQAF VSEGLKPLID GVITFGAGHF YISQSDKGGL VFGGDIDGYN       300
     SYAQRGNLPV IEDVAESGMA LMPRIGRLRL LRMWGGIMDM SMDGSPIIDR APVPGLYLNA       360
     GWCYGGFKAT PASGWCFAHL LAKDEFHDVG GAYRLDRFRT GHLIDEKGVG AQPNLH           416
//

If you have problems or comments...

PBIL Back to PBIL home page