(data stored in ACNUC1104 zone)

EMBL: CP002026.PE466

CP002026.PE466       Location/Qualifiers
FT   CDS             complement(486569..488050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0470"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="TIGRFAM: beta-galactosidase; KEGG: mag:amb0219
FT                   beta-glucosidase A; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87803"
FT                   /db_xref="GOA:D7A385"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:D7A385"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ADH87803.1"
FT                   /translation="MLRRRDFLASAVAATALPALPLGARAQQGQPPVAMPPAPAQVQPL
FT                   SPAGQPQLPPGFVWGASTSSYQIEGAVKEGGRKPSIWDTFSHTPGRIADGTNGDIACDH
FT                   YNRYPGDVELMAKGGFQAYRFSIAWPRVIPDGTGQVNAAGLDFYDRLVDKLMERGILPM
FT                   ACLYHWDLPQALQDRGGWHNRDMAGWFADYARAAVGRLGDRVKPWAMLNEPSVHAIFGH
FT                   GFGNHAPGLTGWPSYVMAQHHQNLAQGTGITAVRALRSNLKLGTVFSLQPIYPASQDPA
FT                   DLAAAQRFDACWNTINLDPLFKGSYPAPFENVFAQLVKPGDMEAIRVPVDFLGMNYYGP
FT                   SWIKHDPAAFLAQAGYGAVPEGTPRTLLGWPISAQGLVEVLTRLRDQYGNPPVFITENG
FT                   ACYEDPAPANGVVQDPERVEYIRAHLVACSEAIRQGCALNGYFAWSLLDNFEWAEGERR
FT                   RFGLINVDFATQQRTPKASYLYLSQVMRAHAAARP"
     MLRRRDFLAS AVAATALPAL PLGARAQQGQ PPVAMPPAPA QVQPLSPAGQ PQLPPGFVWG        60
     ASTSSYQIEG AVKEGGRKPS IWDTFSHTPG RIADGTNGDI ACDHYNRYPG DVELMAKGGF       120
     QAYRFSIAWP RVIPDGTGQV NAAGLDFYDR LVDKLMERGI LPMACLYHWD LPQALQDRGG       180
     WHNRDMAGWF ADYARAAVGR LGDRVKPWAM LNEPSVHAIF GHGFGNHAPG LTGWPSYVMA       240
     QHHQNLAQGT GITAVRALRS NLKLGTVFSL QPIYPASQDP ADLAAAQRFD ACWNTINLDP       300
     LFKGSYPAPF ENVFAQLVKP GDMEAIRVPV DFLGMNYYGP SWIKHDPAAF LAQAGYGAVP       360
     EGTPRTLLGW PISAQGLVEV LTRLRDQYGN PPVFITENGA CYEDPAPANG VVQDPERVEY       420
     IRAHLVACSE AIRQGCALNG YFAWSLLDNF EWAEGERRRF GLINVDFATQ QRTPKASYLY       480
     LSQVMRAHAA ARP                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page