(data stored in ACNUC1104 zone)

EMBL: CP002026.PE468

CP002026.PE468       Location/Qualifiers
FT   CDS             489566..490906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0472"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   aca:ACP_0988 glycosyl hydrolase, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87805"
FT                   /db_xref="GOA:D7A387"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D7A387"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ADH87805.1"
FT                   /translation="MIFHFLSRLLPLAVLLLAAAPLARAQSDAPASPTPGFVRVEGKRF
FT                   VNPDGSTFPIRGMSFGNWLLPEGYMFKFTVQRSPADIEGVIEYLAGPEEAARFWKDFRE
FT                   TYIREEDVAFLAASGFTTVRVPLHWKFFLDPKNPDSVDPNGEGWVLIDRLVGWAKTHGI
FT                   KLILDIHAAPGGQTGVNHDDGVGYPLTFYVPEFKRRTITMWRAIAERYRDETAVLGYDL
FT                   LNEPVTPYHDTDFLNSRLEPFYRDLVTAIREVDPNHPIMLAGAQWSTNFDVFGPPFAEN
FT                   LGYTYHMFWAAPQRSSIQKYANFANRWQVPIFVGETGELNNDWNAQFRALNERFGIGWS
FT                   FWTYKNLDSPSTVASIRKPAGWDAIAHFGSVPRSQWATMDKPSREAVQATLRAYLDNAR
FT                   FANTAVNRGYVASLGLKVPETASTGAPCGRLASLDPAGASQLETPCP"
     MIFHFLSRLL PLAVLLLAAA PLARAQSDAP ASPTPGFVRV EGKRFVNPDG STFPIRGMSF        60
     GNWLLPEGYM FKFTVQRSPA DIEGVIEYLA GPEEAARFWK DFRETYIREE DVAFLAASGF       120
     TTVRVPLHWK FFLDPKNPDS VDPNGEGWVL IDRLVGWAKT HGIKLILDIH AAPGGQTGVN       180
     HDDGVGYPLT FYVPEFKRRT ITMWRAIAER YRDETAVLGY DLLNEPVTPY HDTDFLNSRL       240
     EPFYRDLVTA IREVDPNHPI MLAGAQWSTN FDVFGPPFAE NLGYTYHMFW AAPQRSSIQK       300
     YANFANRWQV PIFVGETGEL NNDWNAQFRA LNERFGIGWS FWTYKNLDSP STVASIRKPA       360
     GWDAIAHFGS VPRSQWATMD KPSREAVQAT LRAYLDNARF ANTAVNRGYV ASLGLKVPET       420
     ASTGAPCGRL ASLDPAGASQ LETPCP                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page