(data stored in ACNUC1104 zone)

EMBL: CP002026.PE469

CP002026.PE469       Location/Qualifiers
FT   CDS             490903..492417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0473"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_6034 malonyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87806"
FT                   /db_xref="GOA:D7A388"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7A388"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADH87806.1"
FT                   /translation="MTNHLFDTLRAGQPEGGRVFIATPEGAVFTYADMERRAAQYANAL
FT                   VSLGVKPGDRVALQVEKSVEAIFAYLGTVRAGGVFLPLNTAYTAPEIDYFLGDAEPAVF
FT                   VCDPAAEATLAPIARARGVAHLFTLDADGKGTLSAAADAAAANFEDVERGPDDLAALLY
FT                   TSGTTGRSKGAMLTHDNLASNALALVDTWRFGPEDVLIHALPIFHTHGLFVATNVILAA
FT                   GASMIFLPKFDPEAILRLMGRASVMMGVPTFYTRLLKAPGLTPEAAAKMRLFISGSAPL
FT                   LADTHREWRARTGHAILERYGMTETGMNTSNPYDGERIAGTVGMPLPGVSLRVVAPDDG
FT                   TELGAGEIGMIEVRGPNVFKGYWRMPEKTAAEFHDGWFVTGDLGLIGPDGYVQIVGRGK
FT                   DLVISGGYNVYPKEIESEIDALDGVVESAVIGLPHADFGEGVTAVVVARPDAALDEKAV
FT                   VAALEGRLARYKLPKRVIFVDDLPRNTMGKVQKNLLREQYKALYAG"
     MTNHLFDTLR AGQPEGGRVF IATPEGAVFT YADMERRAAQ YANALVSLGV KPGDRVALQV        60
     EKSVEAIFAY LGTVRAGGVF LPLNTAYTAP EIDYFLGDAE PAVFVCDPAA EATLAPIARA       120
     RGVAHLFTLD ADGKGTLSAA ADAAAANFED VERGPDDLAA LLYTSGTTGR SKGAMLTHDN       180
     LASNALALVD TWRFGPEDVL IHALPIFHTH GLFVATNVIL AAGASMIFLP KFDPEAILRL       240
     MGRASVMMGV PTFYTRLLKA PGLTPEAAAK MRLFISGSAP LLADTHREWR ARTGHAILER       300
     YGMTETGMNT SNPYDGERIA GTVGMPLPGV SLRVVAPDDG TELGAGEIGM IEVRGPNVFK       360
     GYWRMPEKTA AEFHDGWFVT GDLGLIGPDG YVQIVGRGKD LVISGGYNVY PKEIESEIDA       420
     LDGVVESAVI GLPHADFGEG VTAVVVARPD AALDEKAVVA ALEGRLARYK LPKRVIFVDD       480
     LPRNTMGKVQ KNLLREQYKA LYAG                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page