(data stored in ACNUC1104 zone)

EMBL: CP002026.PE470

CP002026.PE470       Location/Qualifiers
FT   CDS             492477..493037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0474"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: rle:RL0293 putative
FT                   methylated-DNA--protein-cysteine methyltransferase;
FT                   TIGRFAM: methylated-DNA/protein-cysteine methyltransferase;
FT                   PFAM: Methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87807"
FT                   /db_xref="GOA:D7A389"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D7A389"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADH87807.1"
FT                   /translation="MDPLAQHYLVFETARGFCGLAWSAAGITRFQLPTSSAAATERNLL
FT                   RRVPVARPGEPTPEIAETVAAVRRYFDGETVDFSDVRLDLGEQEAFFADIYAALRRVGW
FT                   GATTTYGALAKELGAGPEAARDVGQAMARNPVPLIIPCHRVLAAGGKLGGFSAPGGADT
FT                   KAHMLELEGVDLRPPAPAQGSLF"
     MDPLAQHYLV FETARGFCGL AWSAAGITRF QLPTSSAAAT ERNLLRRVPV ARPGEPTPEI        60
     AETVAAVRRY FDGETVDFSD VRLDLGEQEA FFADIYAALR RVGWGATTTY GALAKELGAG       120
     PEAARDVGQA MARNPVPLII PCHRVLAAGG KLGGFSAPGG ADTKAHMLEL EGVDLRPPAP       180
     AQGSLF                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page