(data stored in ACNUC1104 zone)

EMBL: CP002026.PE473

CP002026.PE473       Location/Qualifiers
FT   CDS             complement(495994..497220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0477"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mdi:METDI1124 putative FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87810"
FT                   /db_xref="GOA:D7A392"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A392"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87810.1"
FT                   /translation="MSRQEGIVIVGAGQGGFQAAASLREAGFTGPVTLVGEEPGLPYQR
FT                   PPLSKAYMKGDAGIEQIELRPAAFFADHDIQIVNARAEAIDRAAQRVVLEGGEALPYAH
FT                   MILATGARNRPLPVPGRELAGVYYLRSHADADALRERLEGARRVVVIGAGFIGLEFAAV
FT                   ARTLGHEVTVIEAAARPLARAVSPEMSAFFADAHTSMGTSLLLGAGVIGLIGAAGHVTG
FT                   VETTDGMVHPADFVVVGIGVTPNVELAAEAGLEVANGIVVDAHLSTMDPAISAIGDAVA
FT                   YPSRFADGLVRLESVQNAVDQAKAVAARLTGRPAPYAAVPWFWSDQSDLKLQMVGLAGP
FT                   TDDAVLRGDPASRRFSVFRFRDGVLTAIESVNRPADHMLGRRLLAGTPTITPEQAADES
FT                   FELKSLLGK"
     MSRQEGIVIV GAGQGGFQAA ASLREAGFTG PVTLVGEEPG LPYQRPPLSK AYMKGDAGIE        60
     QIELRPAAFF ADHDIQIVNA RAEAIDRAAQ RVVLEGGEAL PYAHMILATG ARNRPLPVPG       120
     RELAGVYYLR SHADADALRE RLEGARRVVV IGAGFIGLEF AAVARTLGHE VTVIEAAARP       180
     LARAVSPEMS AFFADAHTSM GTSLLLGAGV IGLIGAAGHV TGVETTDGMV HPADFVVVGI       240
     GVTPNVELAA EAGLEVANGI VVDAHLSTMD PAISAIGDAV AYPSRFADGL VRLESVQNAV       300
     DQAKAVAARL TGRPAPYAAV PWFWSDQSDL KLQMVGLAGP TDDAVLRGDP ASRRFSVFRF       360
     RDGVLTAIES VNRPADHMLG RRLLAGTPTI TPEQAADESF ELKSLLGK                    408
//

If you have problems or comments...

PBIL Back to PBIL home page