(data stored in ACNUC1104 zone)

EMBL: CP002026.PE476

CP002026.PE476       Location/Qualifiers
FT   CDS             complement(499873..500832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0480"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: oan:Oant_1146
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87813"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z3"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH87813.1"
FT                   /translation="MELRRLGRSDILVPPLCFGGNVFGWTADETTSFRLLDGLVEAGFS
FT                   FIDTADVYSRWADGHAGGESETIIGNWMKARGNRAKIVLATKVGGDMGLGKRCLKPDYI
FT                   RSAVEASLKRLQTDYIDLYQSHWDDPETPFEDVLDIYEELIKAGKVRLIGASNLSPARL
FT                   FEALAVATREKLPRYETFQPEYNLYDRAGYENELEPICSGNGLGVITYFSLAAGFLTGK
FT                   YRSAADAQKSVRGRAAVDKYLNDRGRRILAALDQVSAAHGVSPSQVALAWVMARPSVTS
FT                   AIASASKVEQLGDLLASAELRLTNSEISRLDAASAWKE"
     MELRRLGRSD ILVPPLCFGG NVFGWTADET TSFRLLDGLV EAGFSFIDTA DVYSRWADGH        60
     AGGESETIIG NWMKARGNRA KIVLATKVGG DMGLGKRCLK PDYIRSAVEA SLKRLQTDYI       120
     DLYQSHWDDP ETPFEDVLDI YEELIKAGKV RLIGASNLSP ARLFEALAVA TREKLPRYET       180
     FQPEYNLYDR AGYENELEPI CSGNGLGVIT YFSLAAGFLT GKYRSAADAQ KSVRGRAAVD       240
     KYLNDRGRRI LAALDQVSAA HGVSPSQVAL AWVMARPSVT SAIASASKVE QLGDLLASAE       300
     LRLTNSEISR LDAASAWKE                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page