(data stored in ACNUC1104 zone)

EMBL: CP002026.PE477

CP002026.PE477       Location/Qualifiers
FT   CDS             complement(500932..501714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0481"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: mno:Mnod_3729 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87814"
FT                   /db_xref="GOA:D7A3Z4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z4"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADH87814.1"
FT                   /translation="MNISSRQQDILVLARAQGRVSVEDLAGRFEVSPQTIRKDLNDLCV
FT                   RRLMSRVHGGAVVASGVENLAYEARRAMAQGAKRAIAEAAALMVPNRASLFINIGTTTE
FT                   EVARALADHEDLLVITNNLNVATLLYRHPKIELIMAGGPVRHADGAVIGSSAVDFIRQF
FT                   RVDYAVIGASAIEEDGTLLDFDYREVQVARAIIDNARQVILVADRSKLERSAPVRIGAM
FT                   SEVDTFVTDTVSSPELRHVCQREQVELIEVGSLDEDGF"
     MNISSRQQDI LVLARAQGRV SVEDLAGRFE VSPQTIRKDL NDLCVRRLMS RVHGGAVVAS        60
     GVENLAYEAR RAMAQGAKRA IAEAAALMVP NRASLFINIG TTTEEVARAL ADHEDLLVIT       120
     NNLNVATLLY RHPKIELIMA GGPVRHADGA VIGSSAVDFI RQFRVDYAVI GASAIEEDGT       180
     LLDFDYREVQ VARAIIDNAR QVILVADRSK LERSAPVRIG AMSEVDTFVT DTVSSPELRH       240
     VCQREQVELI EVGSLDEDGF                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page