(data stored in ACNUC1104 zone)

EMBL: CP002026.PE48

CP002026.PE48        Location/Qualifiers
FT   CDS             complement(38689..39270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0048"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   atc:AGR_L_1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87385"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX1"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADH87385.1"
FT                   /translation="MTSKLATLTAAAALALAPAVAFSQSPAPESTTPPAASPMAPDAGT
FT                   PQAPASEMPNTNTPSATPTTPPSGDTAAAKPAPSTPKFVSTQSSGQWLGSDLIGTAVVT
FT                   STDEKLGSISDLVLERDGSVIAAVIDVGGFLGIGAKPVAVSFDSLTPTPTDDGQKIVVA
FT                   LTKEELNSAPEFKSLEQMRSETSDAGAKTN"
     MTSKLATLTA AAALALAPAV AFSQSPAPES TTPPAASPMA PDAGTPQAPA SEMPNTNTPS        60
     ATPTTPPSGD TAAAKPAPST PKFVSTQSSG QWLGSDLIGT AVVTSTDEKL GSISDLVLER       120
     DGSVIAAVID VGGFLGIGAK PVAVSFDSLT PTPTDDGQKI VVALTKEELN SAPEFKSLEQ       180
     MRSETSDAGA KTN                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page