(data stored in ACNUC1104 zone)

EMBL: CP002026.PE480

CP002026.PE480       Location/Qualifiers
FT   CDS             complement(504334..504891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0484"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: dac:Daci_4601 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87817"
FT                   /db_xref="GOA:D7A3Z7"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z7"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADH87817.1"
FT                   /translation="MKDRSLVQIALYAAIFAVLGLLPRFDLPIAGGVPITAQSMGAMLA
FT                   GVMLGGWRGALSIVLLLFVVALGAPLLAGGRGGLGVFFTPSVGFLFGWVAAAFVAGWIM
FT                   QKLRKAPVFPAALVASVVGGILVLYAFGIVGMAAMGNLTLKEAAIACLVFIPGDTIKAV
FT                   LVALIAQTVARGMPEALLSRNA"
     MKDRSLVQIA LYAAIFAVLG LLPRFDLPIA GGVPITAQSM GAMLAGVMLG GWRGALSIVL        60
     LLFVVALGAP LLAGGRGGLG VFFTPSVGFL FGWVAAAFVA GWIMQKLRKA PVFPAALVAS       120
     VVGGILVLYA FGIVGMAAMG NLTLKEAAIA CLVFIPGDTI KAVLVALIAQ TVARGMPEAL       180
     LSRNA                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page