(data stored in ACNUC1104 zone)

EMBL: CP002026.PE481

CP002026.PE481       Location/Qualifiers
FT   CDS             complement(504888..505499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0485"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: azc:AZC_3756
FT                   putative cobalt transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87818"
FT                   /db_xref="GOA:D7A3Z8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z8"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADH87818.1"
FT                   /translation="MISLYLPERTWLHGIPAGWKLIALALVSLTVAPFDNPSLMAGLVA
FT                   AVLALYASLGRAALAQIALLRPLWPLFLILLALHWWRGDVLLGAVVILRILAMVLLANA
FT                   VTMTTRMDAMMDAVEPLLRPLALFGVAPRAVALAVAMMIRFVPLLFALWEALNESWRAR
FT                   TGRRGGWRLLAPFCIQTLRMSHHTAEALAARGGAPRGERR"
     MISLYLPERT WLHGIPAGWK LIALALVSLT VAPFDNPSLM AGLVAAVLAL YASLGRAALA        60
     QIALLRPLWP LFLILLALHW WRGDVLLGAV VILRILAMVL LANAVTMTTR MDAMMDAVEP       120
     LLRPLALFGV APRAVALAVA MMIRFVPLLF ALWEALNESW RARTGRRGGW RLLAPFCIQT       180
     LRMSHHTAEA LAARGGAPRG ERR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page