(data stored in ACNUC1104 zone)

EMBL: CP002026.PE482

CP002026.PE482       Location/Qualifiers
FT   CDS             complement(505496..506191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0486"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: azc:AZC_3755 ABC transporter ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87819"
FT                   /db_xref="GOA:D7A3Z9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87819.1"
FT                   /translation="MHGDSLLLENVTLRRGGRVVLDSVSLDLSERRIGLIGNNGSGKSS
FT                   LIRLLNGLLTADEGRVVVHGLDAKEKAAELPRKVGFIFQNPDHQIIFPTVAEEVAFSLE
FT                   QAGMPRREAAKEAIPALARFGRDHWAERPVHALSEGEKQFLCIIAVLVMQPAVLVLDEP
FT                   FSSLDLPTRRRLEALIAGLPQQVILIAHELDAFAGYDRVIWLHEGKVAMDGAPEAVITA
FT                   YRAFVEAGG"
     MHGDSLLLEN VTLRRGGRVV LDSVSLDLSE RRIGLIGNNG SGKSSLIRLL NGLLTADEGR        60
     VVVHGLDAKE KAAELPRKVG FIFQNPDHQI IFPTVAEEVA FSLEQAGMPR REAAKEAIPA       120
     LARFGRDHWA ERPVHALSEG EKQFLCIIAV LVMQPAVLVL DEPFSSLDLP TRRRLEALIA       180
     GLPQQVILIA HELDAFAGYD RVIWLHEGKV AMDGAPEAVI TAYRAFVEAG G                231
//

If you have problems or comments...

PBIL Back to PBIL home page