(data stored in ACNUC1104 zone)

EMBL: CP002026.PE484

CP002026.PE484       Location/Qualifiers
FT   CDS             507279..508274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87821"
FT                   /db_xref="GOA:D7A401"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A401"
FT                   /inference="similar to AA sequence:KEGG:M446_4592"
FT                   /protein_id="ADH87821.1"
FT                   /translation="MSATPLTRPTADADLPDAPEPGLAIGLSAVIVAVTGDDPKVLTIR
FT                   HGDGRDSLPSGPLERGHRTLEVGLRSWVERQTLQELGYVEQLYTFGDRDRGEDGGRALS
FT                   LAYLALVREARPAGDTEAAWQSWYRYFPWEDWRGGRPAVLDSLEHGLRAWAAGAASSRM
FT                   GEIRAERIALCFGGMGGNEAGWNEERVLERYELLYEAGLVAEALRERGSERAASGPSGV
FT                   EMREDHRRMLALAIARLRGKIKYRPVVFEVMPPSFTLGQLQRTVEALSGARLHKQNFRR
FT                   LVEQQRLVEETGETTAETGGRPARLVRFRREVLLERPAPGVRLPGGFGRR"
     MSATPLTRPT ADADLPDAPE PGLAIGLSAV IVAVTGDDPK VLTIRHGDGR DSLPSGPLER        60
     GHRTLEVGLR SWVERQTLQE LGYVEQLYTF GDRDRGEDGG RALSLAYLAL VREARPAGDT       120
     EAAWQSWYRY FPWEDWRGGR PAVLDSLEHG LRAWAAGAAS SRMGEIRAER IALCFGGMGG       180
     NEAGWNEERV LERYELLYEA GLVAEALRER GSERAASGPS GVEMREDHRR MLALAIARLR       240
     GKIKYRPVVF EVMPPSFTLG QLQRTVEALS GARLHKQNFR RLVEQQRLVE ETGETTAETG       300
     GRPARLVRFR REVLLERPAP GVRLPGGFGR R                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page