(data stored in ACNUC1104 zone)

EMBL: CP002026.PE485

CP002026.PE485       Location/Qualifiers
FT   CDS             complement(508275..508700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0489"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bja:bll2568 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87822"
FT                   /db_xref="GOA:D7A402"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7A402"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH87822.1"
FT                   /translation="MDLTLEPALAAEEEAVAALWRECGLTVPYNDPAADFRFALGREAS
FT                   DVLVARQDGRVVATVMVGHDGHRGWLYYVAVAPALQGKGIGAQIVAAGEEWLKARGVVK
FT                   LQLLVRETNTRVVSFYENLGFEIAPRVVMSKWLDGRE"
     MDLTLEPALA AEEEAVAALW RECGLTVPYN DPAADFRFAL GREASDVLVA RQDGRVVATV        60
     MVGHDGHRGW LYYVAVAPAL QGKGIGAQIV AAGEEWLKAR GVVKLQLLVR ETNTRVVSFY       120
     ENLGFEIAPR VVMSKWLDGR E                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page