(data stored in ACNUC1104 zone)

EMBL: CP002026.PE486

CP002026.PE486       Location/Qualifiers
FT   CDS             508880..509950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0490"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="KEGG: mdi:METDI3401 putative quinolinate synthetase
FT                   A (NadA-like); TIGRFAM: quinolinate synthetase complex, A
FT                   subunit; PFAM: Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87823"
FT                   /db_xref="GOA:D7A403"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D7A403"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ADH87823.1"
FT                   /translation="MLDLDVAARMGTTEDFAPDLAPANAPSSPSALPLAHLYERVSKHV
FT                   TPAEWPLIVRDVEAIERLKKQRNAVVLGHNYQAPEIFNTVADIVGDSLALAREAVTVDA
FT                   DVIVMAGVHFMAETAKLLNPSKIVLMPDMEAGCSLAESITAEDIRLLRQRYPGVPVVTY
FT                   VNTSAEVKAESDYCCTSGNAVKVVRAVAKEWGVNRILMLPDEYLARNVQKEVPEIELIA
FT                   WKGHCEVHERFTPQDIRDLRENHPGVVVLAHPECPPEVVAAADYAGSTAGMADYVRDEK
FT                   PARVVLITECSMADNVAVNHPDVEFVRPCNLCPHMRRITLPNIRRALETMGHQVEIDPA
FT                   VADRARLAVERMLAIR"
     MLDLDVAARM GTTEDFAPDL APANAPSSPS ALPLAHLYER VSKHVTPAEW PLIVRDVEAI        60
     ERLKKQRNAV VLGHNYQAPE IFNTVADIVG DSLALAREAV TVDADVIVMA GVHFMAETAK       120
     LLNPSKIVLM PDMEAGCSLA ESITAEDIRL LRQRYPGVPV VTYVNTSAEV KAESDYCCTS       180
     GNAVKVVRAV AKEWGVNRIL MLPDEYLARN VQKEVPEIEL IAWKGHCEVH ERFTPQDIRD       240
     LRENHPGVVV LAHPECPPEV VAAADYAGST AGMADYVRDE KPARVVLITE CSMADNVAVN       300
     HPDVEFVRPC NLCPHMRRIT LPNIRRALET MGHQVEIDPA VADRARLAVE RMLAIR           356
//

If you have problems or comments...

PBIL Back to PBIL home page