(data stored in ACNUC1104 zone)

EMBL: CP002026.PE488

CP002026.PE488       Location/Qualifiers
FT   CDS             511493..512350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0492"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   KEGG: mex:Mext_2646 nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87825"
FT                   /db_xref="GOA:D7A405"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D7A405"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADH87825.1"
FT                   /translation="MTLPPLPRLLVEPVVRAALLEDLGRAGDVTTDSVIPVEARFDAVI
FT                   ASRQTGVIAGIDAAVIAFELIDPSLSIVVERRDGTSVGPGDVVMRLNGSARAILTAERV
FT                   ALNIACRMSGVATATAGLVEIARQHGKAHIVCTRKTTPGLRALEKHAVKAGGGSNHRFG
FT                   LDDAVLIKDNHIAVAGGVAPAIRAAKANAGHMVKIEVEVDTLNQLEEAMAEGVDAVLLD
FT                   NMTPPVLKEAVSIVGGRALTEASGRVSRETVGPIAASGVDLISVGWITHSAPILDLGLD
FT                   AASV"
     MTLPPLPRLL VEPVVRAALL EDLGRAGDVT TDSVIPVEAR FDAVIASRQT GVIAGIDAAV        60
     IAFELIDPSL SIVVERRDGT SVGPGDVVMR LNGSARAILT AERVALNIAC RMSGVATATA       120
     GLVEIARQHG KAHIVCTRKT TPGLRALEKH AVKAGGGSNH RFGLDDAVLI KDNHIAVAGG       180
     VAPAIRAAKA NAGHMVKIEV EVDTLNQLEE AMAEGVDAVL LDNMTPPVLK EAVSIVGGRA       240
     LTEASGRVSR ETVGPIAASG VDLISVGWIT HSAPILDLGL DAASV                       285
//

If you have problems or comments...

PBIL Back to PBIL home page