(data stored in ACNUC1104 zone)

EMBL: CP002026.PE491

CP002026.PE491       Location/Qualifiers
FT   CDS             513749..515044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0495"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="KEGG: bxe:Bxe_B1348 D-amino acid dehydrogenase small
FT                   subunit; PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87828"
FT                   /db_xref="GOA:D7A408"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A408"
FT                   /inference="protein motif:PRIAM:1.4.99.1"
FT                   /protein_id="ADH87828.1"
FT                   /translation="MRQIAVIGAGITGITTAYALNEKGYDVTVIDRQRYAAMETSFANG
FT                   GQLSASNAEVWNSWSTVLKGIKWMFTPDAPLLMNPLPSWHKYSWMAEFLANIPNYKANT
FT                   VETTRLAIQARNYMFEIAARENIDFNHVTRGILHIYRDKVGYDAAAKVSELYAEGGLER
FT                   RPVTPSEIRAIEPTLHGSYYGGFFTPSDSTGDIHKFTRGLADACRRKGVRFINEASVDS
FT                   VTHTGKGQAGTGVEIALTIVPDAEDARPVRETLAFDGVVVCAGVGSRALAAQLGDRVNV
FT                   YPVKGYSITVMLDDEQSQAGAPWVSLLDDQTKIVTSRLGKDRFRVAGTAEFNGENRDIR
FT                   ADRIRPLTDWVRKLFPDVNTDRAVPWAGLRPMMPDLMPRVAAGAKPGVFYNTGHGHLGW
FT                   TLSCATAQIIAGTVASAMPVETPRPALRIAAE"
     MRQIAVIGAG ITGITTAYAL NEKGYDVTVI DRQRYAAMET SFANGGQLSA SNAEVWNSWS        60
     TVLKGIKWMF TPDAPLLMNP LPSWHKYSWM AEFLANIPNY KANTVETTRL AIQARNYMFE       120
     IAARENIDFN HVTRGILHIY RDKVGYDAAA KVSELYAEGG LERRPVTPSE IRAIEPTLHG       180
     SYYGGFFTPS DSTGDIHKFT RGLADACRRK GVRFINEASV DSVTHTGKGQ AGTGVEIALT       240
     IVPDAEDARP VRETLAFDGV VVCAGVGSRA LAAQLGDRVN VYPVKGYSIT VMLDDEQSQA       300
     GAPWVSLLDD QTKIVTSRLG KDRFRVAGTA EFNGENRDIR ADRIRPLTDW VRKLFPDVNT       360
     DRAVPWAGLR PMMPDLMPRV AAGAKPGVFY NTGHGHLGWT LSCATAQIIA GTVASAMPVE       420
     TPRPALRIAA E                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page