(data stored in ACNUC1104 zone)

EMBL: CP002026.PE492

CP002026.PE492       Location/Qualifiers
FT   CDS             515189..516100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0496"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mlo:mlr5377 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87829"
FT                   /db_xref="GOA:D7A409"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A409"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87829.1"
FT                   /translation="MAFSLRQLQYFVAVAENGSVSSAAHTLSISQSTVTEALRELELDL
FT                   GFKLLERHARGADLTLKGHHFLRHARKILGDVADARRAFAGSEAAALDGRLSVGVTPLV
FT                   AGYIYSDLIARFRRAFPRIAVEAVEDAADYLEHLLVGGELDVAVMVLPSGRRSEALQTE
FT                   AVEVSPYRAWMPLGHPALTQERVSLRDLSAEPHVLLTIDEIAEASEGVWRRLGIRPPVA
FT                   FRTRSVEAVRSLVATGAGVAVLPDLTYRPWSLEGDKIEARALIDEVPAVEVATAWRRGS
FT                   PLSAAAAGFVSIAATRHASRGR"
     MAFSLRQLQY FVAVAENGSV SSAAHTLSIS QSTVTEALRE LELDLGFKLL ERHARGADLT        60
     LKGHHFLRHA RKILGDVADA RRAFAGSEAA ALDGRLSVGV TPLVAGYIYS DLIARFRRAF       120
     PRIAVEAVED AADYLEHLLV GGELDVAVMV LPSGRRSEAL QTEAVEVSPY RAWMPLGHPA       180
     LTQERVSLRD LSAEPHVLLT IDEIAEASEG VWRRLGIRPP VAFRTRSVEA VRSLVATGAG       240
     VAVLPDLTYR PWSLEGDKIE ARALIDEVPA VEVATAWRRG SPLSAAAAGF VSIAATRHAS       300
     RGR                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page