(data stored in ACNUC1104 zone)

EMBL: CP002026.PE494

CP002026.PE494       Location/Qualifiers
FT   CDS             517565..517924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ape:APE_2384 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87831"
FT                   /db_xref="GOA:D7A411"
FT                   /db_xref="UniProtKB/TrEMBL:D7A411"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87831.1"
FT                   /translation="MTRRMTAYTATTKGILIGVIAFTAGGAIVAGVVSVWDRAAIALED
FT                   PALQVCEQGEDHAPHPRGGYAFAATHMARMPHGVGTVWQPRLSTADLLPTPSLGERAAH
FT                   AFRTVFSCTPRSTPS"
     MTRRMTAYTA TTKGILIGVI AFTAGGAIVA GVVSVWDRAA IALEDPALQV CEQGEDHAPH        60
     PRGGYAFAAT HMARMPHGVG TVWQPRLSTA DLLPTPSLGE RAAHAFRTVF SCTPRSTPS        119
//

If you have problems or comments...

PBIL Back to PBIL home page