(data stored in ACNUC1104 zone)

EMBL: CP002026.PE498

CP002026.PE498       Location/Qualifiers
FT   CDS             520837..522276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0502"
FT                   /product="Aminobutyraldehyde dehydrogenase"
FT                   /EC_number="1.2.1.19"
FT                   /note="KEGG: ara:Arad_3974 betaine-aldehyde dehydrogenase
FT                   protein; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87835"
FT                   /db_xref="GOA:D7A415"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7A415"
FT                   /inference="protein motif:PRIAM:1.2.1.19"
FT                   /protein_id="ADH87835.1"
FT                   /translation="MTALSDTDMLIGSEFVAGTETPETVLNPKTEETLIELPEASPDQI
FT                   DAAVSAADKAFRTWSRTTPAERSYLLLKLADRIEQEAEAFATLEALNCGKPRHAVLNDE
FT                   IPGVVDCFRFFAGAARTQHGMVAGEYMAGHTSMIRRDPIGVVASIAPWNYPLMMAAWKL
FT                   APALAGGNTVVIKPSEQTPLTLLKLAKVIADIFPEGVVNVVVGRGESVGNALIHHPRVA
FT                   MVSLTGDIATGKKVLTAAAKTVKRTHLELGGKAPVIVFDDADIDAVVEGVKIFGYYNAG
FT                   QDCTAACRIYAGEKVYEKLVADLASAVSGLKFGQADDAQNDIGPLISARQRARVASFVE
FT                   RASELNHIEIATGGKLASGKGFFYEPTVVAGALQSDEIVRREVFGPVVSVTRFEDVDEA
FT                   VAWANDSDYGLASSVWTRDIGKGMATASRLQYGCTWVNCHFMLVNEMPHGGLKQSGYGK
FT                   DLSAYALEDYTVVRHVMVKNG"
     MTALSDTDML IGSEFVAGTE TPETVLNPKT EETLIELPEA SPDQIDAAVS AADKAFRTWS        60
     RTTPAERSYL LLKLADRIEQ EAEAFATLEA LNCGKPRHAV LNDEIPGVVD CFRFFAGAAR       120
     TQHGMVAGEY MAGHTSMIRR DPIGVVASIA PWNYPLMMAA WKLAPALAGG NTVVIKPSEQ       180
     TPLTLLKLAK VIADIFPEGV VNVVVGRGES VGNALIHHPR VAMVSLTGDI ATGKKVLTAA       240
     AKTVKRTHLE LGGKAPVIVF DDADIDAVVE GVKIFGYYNA GQDCTAACRI YAGEKVYEKL       300
     VADLASAVSG LKFGQADDAQ NDIGPLISAR QRARVASFVE RASELNHIEI ATGGKLASGK       360
     GFFYEPTVVA GALQSDEIVR REVFGPVVSV TRFEDVDEAV AWANDSDYGL ASSVWTRDIG       420
     KGMATASRLQ YGCTWVNCHF MLVNEMPHGG LKQSGYGKDL SAYALEDYTV VRHVMVKNG        479
//

If you have problems or comments...

PBIL Back to PBIL home page