(data stored in ACNUC1104 zone)

EMBL: CP002026.PE499

CP002026.PE499       Location/Qualifiers
FT   CDS             522474..523574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0503"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: bpt:Bpet0632 RND efflux membrane fusion
FT                   protein; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87836"
FT                   /db_xref="GOA:D7A416"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A416"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87836.1"
FT                   /translation="MRRSTGVLLTVAVLVGAGALAQQRGWIDVGALVGGRGEANAAAEP
FT                   KPAPHIPVEVAPARQVTVTTDISSIGSLQSDESVKVASEVAGRIQEIRFKEGEQVKAGD
FT                   VLVQLDAALVKASLDETEARLDLAEANFSRAQKLQASGSGTARALDEAQAELNTSRALL
FT                   HSQRVQIAKHTITAPFDGVVGLRSVSNGAYIDTGDELVNLEKIDTLKLDFKVPERHLAS
FT                   VSPGQTVMVSVDALPSRTFTGTIYAIDPMVDVNGRSLSVRARLDNAQMALRPGLFARVT
FT                   IKGRETRDAVFVPESAIVPRGQERLVWQVVDGKAREAKVQLGQRGNGEVEIKGVPAGAT
FT                   IVVAGQGRLQPDALVEVVTPPPAPQG"
     MRRSTGVLLT VAVLVGAGAL AQQRGWIDVG ALVGGRGEAN AAAEPKPAPH IPVEVAPARQ        60
     VTVTTDISSI GSLQSDESVK VASEVAGRIQ EIRFKEGEQV KAGDVLVQLD AALVKASLDE       120
     TEARLDLAEA NFSRAQKLQA SGSGTARALD EAQAELNTSR ALLHSQRVQI AKHTITAPFD       180
     GVVGLRSVSN GAYIDTGDEL VNLEKIDTLK LDFKVPERHL ASVSPGQTVM VSVDALPSRT       240
     FTGTIYAIDP MVDVNGRSLS VRARLDNAQM ALRPGLFARV TIKGRETRDA VFVPESAIVP       300
     RGQERLVWQV VDGKAREAKV QLGQRGNGEV EIKGVPAGAT IVVAGQGRLQ PDALVEVVTP       360
     PPAPQG                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page