(data stored in ACNUC1104 zone)

EMBL: CP002026.PE5

CP002026.PE5         Location/Qualifiers
FT   CDS             3506..3820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_2399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87342"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS8"
FT                   /inference="similar to AA sequence:KEGG:Nham_2399"
FT                   /protein_id="ADH87342.1"
FT                   /translation="MTREVLPARRFAENVSFFLGKILYSVTLGFYDDGRVGEVFIGGPK
FT                   TGSDAETNARDAAAILSIAMQYGVPPSAFSTAVQRDSSGVPLGPIGAVVDLLAPQDGGA
FT                   "
     MTREVLPARR FAENVSFFLG KILYSVTLGF YDDGRVGEVF IGGPKTGSDA ETNARDAAAI        60
     LSIAMQYGVP PSAFSTAVQR DSSGVPLGPI GAVVDLLAPQ DGGA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page