(data stored in ACNUC1104 zone)

EMBL: CP002026.PE50

CP002026.PE50        Location/Qualifiers
FT   CDS             complement(40077..41405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0050"
FT                   /product="signal transduction histidine kinase"
FT                   /note="KEGG: rru:Rru_A0741 signal transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: HWE histidine
FT                   kinase; PAS fold-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87387"
FT                   /db_xref="GOA:D6ZZX3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH87387.1"
FT                   /translation="MPPLTLDLIDDAARWVTILSSLAIAVGLVRLLQLRPDFSGRTRLL
FT                   TALLVALVSMFALLMLLAIFNGSRMSPDWLQSAVRIGIAALSAVGATALWINFRALVNM
FT                   PSPGHVASEQRRLTLELATALQRYEMALRGSKVAIFTQDRDLRYTSVSKPLFGYPVEQV
FT                   LGSTDADLLGDAQSQPIALIKRESLAASAARKGETEVNEDGGRFWYDIHIEPLRDLSGA
FT                   TVGLTGAVVDVTERKENEQHLRLLMRELTHRSKNLLAVIQAMARQTARHAGSIDEFVEI
FT                   FSARLQALSRSHDLLVQESWHGAALIDMVRSQLGHHIDRENSQVSVTGPNIFLKPEAAQ
FT                   NIGLALHELSTNAAKYGALSVPSGHVDITWARRMAEAGGGFELSWRESGGPPVTVPSGR
FT                   GFGSLVIERNLARALDGEVDLDFAPAGLVCHVTVPEHHLTAGR"
     MPPLTLDLID DAARWVTILS SLAIAVGLVR LLQLRPDFSG RTRLLTALLV ALVSMFALLM        60
     LLAIFNGSRM SPDWLQSAVR IGIAALSAVG ATALWINFRA LVNMPSPGHV ASEQRRLTLE       120
     LATALQRYEM ALRGSKVAIF TQDRDLRYTS VSKPLFGYPV EQVLGSTDAD LLGDAQSQPI       180
     ALIKRESLAA SAARKGETEV NEDGGRFWYD IHIEPLRDLS GATVGLTGAV VDVTERKENE       240
     QHLRLLMREL THRSKNLLAV IQAMARQTAR HAGSIDEFVE IFSARLQALS RSHDLLVQES       300
     WHGAALIDMV RSQLGHHIDR ENSQVSVTGP NIFLKPEAAQ NIGLALHELS TNAAKYGALS       360
     VPSGHVDITW ARRMAEAGGG FELSWRESGG PPVTVPSGRG FGSLVIERNL ARALDGEVDL       420
     DFAPAGLVCH VTVPEHHLTA GR                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page