(data stored in ACNUC1104 zone)

EMBL: CP002026.PE502

CP002026.PE502       Location/Qualifiers
FT   CDS             528440..529549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0506"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: met:M446_1974 ABC transporter related; PFAM:
FT                   ABC transporter related; TOBE domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87839"
FT                   /db_xref="GOA:D7A419"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A419"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87839.1"
FT                   /translation="MILELDGVSRTVAGVPYIRDVSLRLEHGSLNVLLGATLAGKTSLM
FT                   RLMAGLDAPTSGRILVDGRDVTGLPVKKRSVAMVYQQFINYPSLSVYENIASPLRVQGL
FT                   PKAEIETRVTEAAKLLKLEPYLQRLPLALSGGQQQRTAIARALVKRADLVLLDEPLANL
FT                   DYKLREELREELPRIFASTGAVFVYATTEPTEALLLGGNTATLMEGAVTQFGPTADVYR
FT                   RPADLATARVFSDPPLNMLKVTKSSGTVLLESGAVLPASGTFATAADGRYTMGVRAHHL
FT                   EVEDVAVAERTSHADGRIRLGAVISVTEVTGSESFLHMQMGEERLTALVPGVRRLEPNA
FT                   PVEVLIDPSHILLFDADGRRAGRVLDAAA"
     MILELDGVSR TVAGVPYIRD VSLRLEHGSL NVLLGATLAG KTSLMRLMAG LDAPTSGRIL        60
     VDGRDVTGLP VKKRSVAMVY QQFINYPSLS VYENIASPLR VQGLPKAEIE TRVTEAAKLL       120
     KLEPYLQRLP LALSGGQQQR TAIARALVKR ADLVLLDEPL ANLDYKLREE LREELPRIFA       180
     STGAVFVYAT TEPTEALLLG GNTATLMEGA VTQFGPTADV YRRPADLATA RVFSDPPLNM       240
     LKVTKSSGTV LLESGAVLPA SGTFATAADG RYTMGVRAHH LEVEDVAVAE RTSHADGRIR       300
     LGAVISVTEV TGSESFLHMQ MGEERLTALV PGVRRLEPNA PVEVLIDPSH ILLFDADGRR       360
     AGRVLDAAA                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page