(data stored in ACNUC1104 zone)

EMBL: CP002026.PE504

CP002026.PE504       Location/Qualifiers
FT   CDS             530658..531560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0508"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpt:Rpal_4892
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87841"
FT                   /db_xref="GOA:D7A421"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A421"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87841.1"
FT                   /translation="MDKPVNNRAWLLVAPVFLIVAFSAIVPIMTVVNYSVQDTFGNNQF
FT                   FWNGLGWFQELLDPSTELGGRFFDALWRNLLFSAIILAIEVPLGILVALSMPREGWKVA
FT                   ATLVVMALPLLIPWNVVGTIWQVFARADIGLLGYAVNWLGIPYNYTGDTLAAWITIIVM
FT                   DVWHWTSLVALLCYAGLKSIPDAYYQAARIDGASRWAVFTTIQLPKMKRVLLIAVLLRF
FT                   MDSFMIYTEPFVLTGGGPGNATTFLSIDLVKIALGQFDLGKAAAMSLVYNLIVLALCWV
FT                   FYTVMINAGTERRKQETPA"
     MDKPVNNRAW LLVAPVFLIV AFSAIVPIMT VVNYSVQDTF GNNQFFWNGL GWFQELLDPS        60
     TELGGRFFDA LWRNLLFSAI ILAIEVPLGI LVALSMPREG WKVAATLVVM ALPLLIPWNV       120
     VGTIWQVFAR ADIGLLGYAV NWLGIPYNYT GDTLAAWITI IVMDVWHWTS LVALLCYAGL       180
     KSIPDAYYQA ARIDGASRWA VFTTIQLPKM KRVLLIAVLL RFMDSFMIYT EPFVLTGGGP       240
     GNATTFLSID LVKIALGQFD LGKAAAMSLV YNLIVLALCW VFYTVMINAG TERRKQETPA       300
//

If you have problems or comments...

PBIL Back to PBIL home page