(data stored in ACNUC1104 zone)

EMBL: CP002026.PE506

CP002026.PE506       Location/Qualifiers
FT   CDS             532386..532691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0510"
FT                   /product="Protein of unknown function DUF2160,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF2160,
FT                   transmembrane; KEGG: met:M446_1970 small integral membrane
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87843"
FT                   /db_xref="GOA:D7A423"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:D7A423"
FT                   /inference="protein motif:PFAM:PF09928"
FT                   /protein_id="ADH87843.1"
FT                   /translation="METGTSLLPESLAWMAWTWQTGLFFAVIASLLLVFTLLALWRPER
FT                   ARVGVLGIPTTRGDRLFITLLGSAFINLAWLGLVGPDLGWALALCLVYALAVFRLV"
     METGTSLLPE SLAWMAWTWQ TGLFFAVIAS LLLVFTLLAL WRPERARVGV LGIPTTRGDR        60
     LFITLLGSAF INLAWLGLVG PDLGWALALC LVYALAVFRL V                           101
//

If you have problems or comments...

PBIL Back to PBIL home page