(data stored in ACNUC1104 zone)

EMBL: CP002026.PE509

CP002026.PE509       Location/Qualifiers
FT   CDS             535721..536476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0513"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bra:BRADO6233 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87846"
FT                   /db_xref="GOA:D7A426"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A426"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87846.1"
FT                   /translation="MVDEAAGAGALRPMSVNPLEEMGGEAEARSLTSATYRRLKKDILA
FT                   CALQPGQRLKISDLAAQYGCSPGAVREALTRLVAEELVVSEDQRGFRVAPVSRSDLLDL
FT                   TQTRIDIETAALRHAIAKGGLDWQAGIVSTIFRLSNEPVLDDSGAPNPRWSKLHQDFHM
FT                   ALVAGCNSPRLMRLCLAYFHQSQRFRVLTIRYHERGRSADAEHRELADAVIGRDAERAV
FT                   RLLADHYNRTTNLIIDVDRDGDLSMLTAT"
     MVDEAAGAGA LRPMSVNPLE EMGGEAEARS LTSATYRRLK KDILACALQP GQRLKISDLA        60
     AQYGCSPGAV REALTRLVAE ELVVSEDQRG FRVAPVSRSD LLDLTQTRID IETAALRHAI       120
     AKGGLDWQAG IVSTIFRLSN EPVLDDSGAP NPRWSKLHQD FHMALVAGCN SPRLMRLCLA       180
     YFHQSQRFRV LTIRYHERGR SADAEHRELA DAVIGRDAER AVRLLADHYN RTTNLIIDVD       240
     RDGDLSMLTA T                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page