(data stored in ACNUC1104 zone)

EMBL: CP002026.PE510

CP002026.PE510       Location/Qualifiers
FT   CDS             536579..537316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0514"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:bll7370
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87847"
FT                   /db_xref="GOA:D7A427"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A427"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH87847.1"
FT                   /translation="MDSAFIEPTLDAGAAVGQLVLVPGLGCTEQLFAGQVCRLARHSRV
FT                   RFADTRRDDTIAGMARRLLEEVDGPFALAGLSMGGYVAMEVVRQAPSRVTRLALLDTTA
FT                   APDAESAREFRLKLSDLALRGHLDEVHEALWPRLVAPSRRDDAVLEGQVYSMLVATGGA
FT                   AFARQQNAIIGRADSRPVLEGVAVPTLIVVGSEDIVTPVATAAEMAGLVPGARLTVVEG
FT                   SGHLSTMEAAATVADAMEEWLTH"
     MDSAFIEPTL DAGAAVGQLV LVPGLGCTEQ LFAGQVCRLA RHSRVRFADT RRDDTIAGMA        60
     RRLLEEVDGP FALAGLSMGG YVAMEVVRQA PSRVTRLALL DTTAAPDAES AREFRLKLSD       120
     LALRGHLDEV HEALWPRLVA PSRRDDAVLE GQVYSMLVAT GGAAFARQQN AIIGRADSRP       180
     VLEGVAVPTL IVVGSEDIVT PVATAAEMAG LVPGARLTVV EGSGHLSTME AAATVADAME       240
     EWLTH                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page