(data stored in ACNUC1104 zone)

EMBL: CP002026.PE511

CP002026.PE511       Location/Qualifiers
FT   CDS             537402..539144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0515"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avn:Avin_21310 ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87848"
FT                   /db_xref="GOA:D7A428"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A428"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87848.1"
FT                   /translation="MSSIAAASGVARPSAASRWLSLETFVLGGAILSLVILVVLPVASL
FT                   VVASLWSEDGVTLAYYERALTGGSYLRALGNSLTLGAWVGLISVIVGVPLAWAVSRTNV
FT                   PGKPLIQATATLSYLSPPFLTSIAFVNLFSPNAGIINVLLRDVLGLGITFDIFTMSGLV
FT                   FVTALHTFPFVYLLASSALQSVDASYEEAAQILGASKIRTALTITAPLVAPAILSGTLL
FT                   AFVNAIALFGSQAIIGLPGRIVTLPTRIYALFDYPPQYGLAAALSLLFVAITVIALYLQ
FT                   RMFLARRSYVTLGGKGARSQLVDLGPWRWVLFGVCVLVCLFAVVMPFASLIAVSLSKSW
FT                   GLDFWQSLTLDNYRFILFEYDVTRRAILNSLVLATIAATACVALGAIIGWIDVRTKMPG
FT                   RRLLDYASLVPLGLPGIVMAVALLQFWLSVPYIVLYGTFAILLLAYIGRYVPLGVRAAN
FT                   SSLRQVDPSLEEAAHILGASWGHTMREITLPLIRPGLLAGWLLVFVPVVQELSASILLF
FT                   SSGTITLAVAVYNLYETGYIEPVSALAMVNMTIIVVAMLIAHRLGAGRKTVSDDSSTSF
FT                   GGAR"
     MSSIAAASGV ARPSAASRWL SLETFVLGGA ILSLVILVVL PVASLVVASL WSEDGVTLAY        60
     YERALTGGSY LRALGNSLTL GAWVGLISVI VGVPLAWAVS RTNVPGKPLI QATATLSYLS       120
     PPFLTSIAFV NLFSPNAGII NVLLRDVLGL GITFDIFTMS GLVFVTALHT FPFVYLLASS       180
     ALQSVDASYE EAAQILGASK IRTALTITAP LVAPAILSGT LLAFVNAIAL FGSQAIIGLP       240
     GRIVTLPTRI YALFDYPPQY GLAAALSLLF VAITVIALYL QRMFLARRSY VTLGGKGARS       300
     QLVDLGPWRW VLFGVCVLVC LFAVVMPFAS LIAVSLSKSW GLDFWQSLTL DNYRFILFEY       360
     DVTRRAILNS LVLATIAATA CVALGAIIGW IDVRTKMPGR RLLDYASLVP LGLPGIVMAV       420
     ALLQFWLSVP YIVLYGTFAI LLLAYIGRYV PLGVRAANSS LRQVDPSLEE AAHILGASWG       480
     HTMREITLPL IRPGLLAGWL LVFVPVVQEL SASILLFSSG TITLAVAVYN LYETGYIEPV       540
     SALAMVNMTI IVVAMLIAHR LGAGRKTVSD DSSTSFGGAR                             580
//

If you have problems or comments...

PBIL Back to PBIL home page