(data stored in ACNUC1104 zone)

EMBL: CP002026.PE512

CP002026.PE512       Location/Qualifiers
FT   CDS             539144..540232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0516"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tga:TGAM_1014 ABC-type transport system,
FT                   ATPase component, putative Fe3+ transporter (FbpC/AfuC);
FT                   PFAM: ABC transporter related; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87849"
FT                   /db_xref="GOA:D7A429"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A429"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87849.1"
FT                   /translation="MARILISGLTKSYTGNGAALSALDLDIKDNQFVTLLGPSGCGKTT
FT                   TLRLIAGYMTPDAGTIRVGDRVISSAEGVAPPDKRGMGMVFQNYAVWPHKTVYENVVFG
FT                   LKLRRIPSEEARRRVLETLALVNLTGLENRFPAELSGGQQQRVALARSLVVEPEILLLD
FT                   EPLSNLDAKLRERMRLELKQLQRRTGITFVYVTHDQAEALALSDQIAVMHGGKLQQYGT
FT                   PDDVYRRPANKIVADFMGIVNFVPGIARGGETIEIDGVEMRSPHAGGLVPGEPIDVAVR
FT                   PENVRLSRDGADGKRLTGTITEKTYLGNLIEYWVQLASGAVLRAQTHPLEQFDPGEAVG
FT                   LVIDAQESSVFPRGEASPSTKH"
     MARILISGLT KSYTGNGAAL SALDLDIKDN QFVTLLGPSG CGKTTTLRLI AGYMTPDAGT        60
     IRVGDRVISS AEGVAPPDKR GMGMVFQNYA VWPHKTVYEN VVFGLKLRRI PSEEARRRVL       120
     ETLALVNLTG LENRFPAELS GGQQQRVALA RSLVVEPEIL LLDEPLSNLD AKLRERMRLE       180
     LKQLQRRTGI TFVYVTHDQA EALALSDQIA VMHGGKLQQY GTPDDVYRRP ANKIVADFMG       240
     IVNFVPGIAR GGETIEIDGV EMRSPHAGGL VPGEPIDVAV RPENVRLSRD GADGKRLTGT       300
     ITEKTYLGNL IEYWVQLASG AVLRAQTHPL EQFDPGEAVG LVIDAQESSV FPRGEASPST       360
     KH                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page