(data stored in ACNUC1104 zone)

EMBL: CP002026.PE514

CP002026.PE514       Location/Qualifiers
FT   CDS             541225..542262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0518"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tga:TGAM_1016 ABC-type Fe3+ transport system,
FT                   periplasmic component (FbpA/AfuA)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87851"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D7A431"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87851.1"
FT                   /translation="MLKNAIVHRSVRCWLAAGAGLLIGSFAFAASAEEVDMAKAKAEGK
FT                   LVWYTSTAIGQANNLALMFEKQTGIKVELFRSGGSAILRRFMQEASAGKIAADVMTMSD
FT                   PAAADQLSEKGTFVAFKPKDFDKITETARNKDGYWIAQRLNAITIYMRGDKVPPAERPK
FT                   KWTDLTDAKYDGKLVMTDPSFTSVQLTTVGVLADKYGWDYYEKLNDGDIMIVQGNQQVA
FT                   DNIKRGERLIAVGALDVYIAADRRNGHDFVSIYPEDGTLLIPSPTGIIKGGPHPNAAKA
FT                   FAEFMISPEAQKTFPETGEYSARVDMAPPAGNPKVDEIKLMPVDYEKLETQAAEIKEKF
FT                   NDIFR"
     MLKNAIVHRS VRCWLAAGAG LLIGSFAFAA SAEEVDMAKA KAEGKLVWYT STAIGQANNL        60
     ALMFEKQTGI KVELFRSGGS AILRRFMQEA SAGKIAADVM TMSDPAAADQ LSEKGTFVAF       120
     KPKDFDKITE TARNKDGYWI AQRLNAITIY MRGDKVPPAE RPKKWTDLTD AKYDGKLVMT       180
     DPSFTSVQLT TVGVLADKYG WDYYEKLNDG DIMIVQGNQQ VADNIKRGER LIAVGALDVY       240
     IAADRRNGHD FVSIYPEDGT LLIPSPTGII KGGPHPNAAK AFAEFMISPE AQKTFPETGE       300
     YSARVDMAPP AGNPKVDEIK LMPVDYEKLE TQAAEIKEKF NDIFR                       345
//

If you have problems or comments...

PBIL Back to PBIL home page