(data stored in ACNUC1104 zone)

EMBL: CP002026.PE517

CP002026.PE517       Location/Qualifiers
FT   CDS             complement(543903..545039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0521"
FT                   /product="putative GAF sensor protein"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: GAF domain protein; regulatory protein MerR;
FT                   KEGG: rpe:RPE_2603 putative GAF sensor protein; SMART: GAF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87854"
FT                   /db_xref="GOA:D7A434"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D7A434"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADH87854.1"
FT                   /translation="MGKTDKDILTTADTARLLGVSIRTAQLLIEGGSVPSWKTPGGHRR
FT                   VYRADIMALIEKRAQDEALPSATVIVVAPAERLAFYERLFADVAECTAEVFDDVHDALF
FT                   AIGSARPYAILVDLDETDPERLALLNNVASNPSLGHTRLLAVAASARALPDRVLRLDAP
FT                   DQAPAAIRASLADAGEVIVAQDDLPFPIALNESQRLVALERSGLLDTAPEEAFDRLTWL
FT                   AARNLDAPIALLTLLTPTRQWFKSRFGLDLPETPRSWAFCNHTILQKGVFSVEDLSRDP
FT                   RFAKNPAVQGQPLFRFYAGAPVMDNEGFTVGSLCVIDYKPRKLDEREAQTLMALAALAS
FT                   DEVRLRAIDRQLRETLRRVERQAPVRTGTATAPHKRDH"
     MGKTDKDILT TADTARLLGV SIRTAQLLIE GGSVPSWKTP GGHRRVYRAD IMALIEKRAQ        60
     DEALPSATVI VVAPAERLAF YERLFADVAE CTAEVFDDVH DALFAIGSAR PYAILVDLDE       120
     TDPERLALLN NVASNPSLGH TRLLAVAASA RALPDRVLRL DAPDQAPAAI RASLADAGEV       180
     IVAQDDLPFP IALNESQRLV ALERSGLLDT APEEAFDRLT WLAARNLDAP IALLTLLTPT       240
     RQWFKSRFGL DLPETPRSWA FCNHTILQKG VFSVEDLSRD PRFAKNPAVQ GQPLFRFYAG       300
     APVMDNEGFT VGSLCVIDYK PRKLDEREAQ TLMALAALAS DEVRLRAIDR QLRETLRRVE       360
     RQAPVRTGTA TAPHKRDH                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page