(data stored in ACNUC1104 zone)

EMBL: CP002026.PE518

CP002026.PE518       Location/Qualifiers
FT   CDS             545425..547044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0522"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: mrd:Mrad2831_0323
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87855"
FT                   /db_xref="GOA:D7A435"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A435"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ADH87855.1"
FT                   /translation="MITQAAHAEDRDFSRRAHENQARLTAGLKPSYDFIVCGAGASGSV
FT                   VARRLAENPDVHVLLIEAGGSDDAETVLDPAQWPANLGSERDWGFQAQPNPHLNGRALP
FT                   MSMGKGLGGGSSINVMVWARGHRSDWDHFAAEADDPAWGYDAVLDIYRRIENWQGAPDP
FT                   DYRGTSGPVWVQPAPDPSPIAGAMVDAARELGIPAYDHPNGRMMEGAGGAAISDALIRD
FT                   GRRHSLYRAYVRPMLDRPNLTVLTDTLVRRVLFTGRRATGVEIVRGGEVLIVGAEKEIV
FT                   LSLGAIHTPKVLMHSGIGDRAELDRFAIPVVQHLPGVGQNLQDHVSFGCIWDYAEPLAP
FT                   RNSGSEATLYWKSRPDLDAPDLLFCQLEFPVASERTAARGVPEHGWTMFAGLAQPASRG
FT                   RVRLQDSDPLAPVAIDANMLSDPADMDTAVACVELCRELGNAHAFRPLVRGEAMPGNLK
FT                   GEALRQFIREAAVTYWHQSCTAKMGRDPMSVVDASLRVYGVDGLRVADGSIMPRVATGN
FT                   TQAPCAVIGERAAAMLRTAHGL"
     MITQAAHAED RDFSRRAHEN QARLTAGLKP SYDFIVCGAG ASGSVVARRL AENPDVHVLL        60
     IEAGGSDDAE TVLDPAQWPA NLGSERDWGF QAQPNPHLNG RALPMSMGKG LGGGSSINVM       120
     VWARGHRSDW DHFAAEADDP AWGYDAVLDI YRRIENWQGA PDPDYRGTSG PVWVQPAPDP       180
     SPIAGAMVDA ARELGIPAYD HPNGRMMEGA GGAAISDALI RDGRRHSLYR AYVRPMLDRP       240
     NLTVLTDTLV RRVLFTGRRA TGVEIVRGGE VLIVGAEKEI VLSLGAIHTP KVLMHSGIGD       300
     RAELDRFAIP VVQHLPGVGQ NLQDHVSFGC IWDYAEPLAP RNSGSEATLY WKSRPDLDAP       360
     DLLFCQLEFP VASERTAARG VPEHGWTMFA GLAQPASRGR VRLQDSDPLA PVAIDANMLS       420
     DPADMDTAVA CVELCRELGN AHAFRPLVRG EAMPGNLKGE ALRQFIREAA VTYWHQSCTA       480
     KMGRDPMSVV DASLRVYGVD GLRVADGSIM PRVATGNTQA PCAVIGERAA AMLRTAHGL        539
//

If you have problems or comments...

PBIL Back to PBIL home page