(data stored in ACNUC1104 zone)

EMBL: CP002026.PE519

CP002026.PE519       Location/Qualifiers
FT   CDS             547189..547965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0523"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bja:blr2694 VirG-like two component response
FT                   regulator; PFAM: transcriptional regulator domain protein;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87856"
FT                   /db_xref="GOA:D7A436"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7A436"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87856.1"
FT                   /translation="MHQLVSVSRHEVPANPLDRPFPLGRVLVVDDDRDMRHAVIGHLNE
FT                   HRCHAVGCGVRDMPHHLRHDQFSLIVLDVQSGPPDRFAVLRQIRDRSPVPVILVACQRC
FT                   NDADRIVALELGADDCLIKPFDPRELLARAGAILRRQEMGRQLTARPVRGGYRFNGWEL
FT                   RRRTRRLTDPSGKAVDLTKGGYALLVAFLEAPLRPLSREQLLSATRTHQDVFDRSIDVQ
FT                   VLRLRRKLEPDPAQPRLIRTERGIGYVFDAAVETVF"
     MHQLVSVSRH EVPANPLDRP FPLGRVLVVD DDRDMRHAVI GHLNEHRCHA VGCGVRDMPH        60
     HLRHDQFSLI VLDVQSGPPD RFAVLRQIRD RSPVPVILVA CQRCNDADRI VALELGADDC       120
     LIKPFDPREL LARAGAILRR QEMGRQLTAR PVRGGYRFNG WELRRRTRRL TDPSGKAVDL       180
     TKGGYALLVA FLEAPLRPLS REQLLSATRT HQDVFDRSID VQVLRLRRKL EPDPAQPRLI       240
     RTERGIGYVF DAAVETVF                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page