(data stored in ACNUC1104 zone)

EMBL: CP002026.PE521

CP002026.PE521       Location/Qualifiers
FT   CDS             548987..549730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0525"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   scl:sce1411 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87858"
FT                   /db_xref="GOA:D7A438"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A438"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87858.1"
FT                   /translation="MKTILITGCSSGYGLETARYFHCRGWTVVATMRNPREDLLPSSER
FT                   MRILPLDVTNPESIAAAFENSGPIDVLVNNAGIGVVGAFEATPMEHVRKVFETNTFGVM
FT                   AMTQAAIRQFRARRSGVIVNVTSSVTLAAMPLAAAYTASKMAIEGFTASLAFELAAFGV
FT                   RVKLVEPGYAPTTRFAQNVDIDIADLIPPDYAPFAEPIFAEYAQPAMVTREIDVAEAIW
FT                   QAATDIEGRLRFPAGADAVALAQLG"
     MKTILITGCS SGYGLETARY FHCRGWTVVA TMRNPREDLL PSSERMRILP LDVTNPESIA        60
     AAFENSGPID VLVNNAGIGV VGAFEATPME HVRKVFETNT FGVMAMTQAA IRQFRARRSG       120
     VIVNVTSSVT LAAMPLAAAY TASKMAIEGF TASLAFELAA FGVRVKLVEP GYAPTTRFAQ       180
     NVDIDIADLI PPDYAPFAEP IFAEYAQPAM VTREIDVAEA IWQAATDIEG RLRFPAGADA       240
     VALAQLG                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page