(data stored in ACNUC1104 zone)

EMBL: CP002026.PE523

CP002026.PE523       Location/Qualifiers
FT   CDS             550797..553289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dma:DMR_29330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87860"
FT                   /db_xref="UniProtKB/TrEMBL:D7A440"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87860.1"
FT                   /translation="MWKDPVGNTPSIVQTNFGPWGTSLPADGESYCAPTSVVMGLYYLG
FT                   GNGFTQLAPASYAGPDDRESILFERLIAGIIGTSPTQGTGSLAGLADYFAARGLGLDQY
FT                   TYISTGIPDVQWLDTQLAPNYVEDPQWISLTVFSVGWFYKPKDDEPTCGCTLCNDGGHT
FT                   LAPLKVDLFTQKVTLNNAYPMSFLDVPNEPSSNPQTVELQLVPEGMTVEGLNDPQQYSE
FT                   VMTDILGSGDDFAILWLAESWIISASALPTTPGYAPATWQIDGPKSLNTNEATLTVLAP
FT                   LAGRGGFVKYGEGTLLLTNSNRLMGRNEVCNGTLASTLTTDTPFGTWTVVLRNGGALAL
FT                   APETSDPVAVEIASGHLARFIVDAGGGTLRLDGTNSYSVTLGGCDDGELPNIVLANDGT
FT                   LAIAPGGGISALGTSQKVLVTGTDGNLPIVTDGIVTPAILGIDTDLSGKFVTYDVTSGF
FT                   IAASPTLSTSLGINSVTVSTVYEVVDEQVIDSGAAPQLAALELNGGTVSGSGAQLLVGN
FT                   QAAGGVAGIIMNAGSIGVDTLTIGAAAAIVYASTSDGLEISSNLSGSGGLSLFGPGTLT
FT                   LSADNSGSLSGMVNVNTGTLIAAGTSATGSGTVQVHSAGRLEVTGSVAGPIDVAQGATL
FT                   HLENGTLEGAVSIAAVGDSPMPGGIFEGAGVISGEATIGGIVRPGPLTGILEFQATATI
FT                   AGSAMIYWRLEKLVADVDSKPGEGWNGYLFNDASSGVGLSGDAPMYLLEFAGLGVHPDA
FT                   GDPFWKQPRRWQFMMFPNGYANIWFGDGNLYYSAGNFGLVLESDNSVYLTWTPTDPQGP
FT                   AQRRRAQIAARNRSLSRK"
     MWKDPVGNTP SIVQTNFGPW GTSLPADGES YCAPTSVVMG LYYLGGNGFT QLAPASYAGP        60
     DDRESILFER LIAGIIGTSP TQGTGSLAGL ADYFAARGLG LDQYTYISTG IPDVQWLDTQ       120
     LAPNYVEDPQ WISLTVFSVG WFYKPKDDEP TCGCTLCNDG GHTLAPLKVD LFTQKVTLNN       180
     AYPMSFLDVP NEPSSNPQTV ELQLVPEGMT VEGLNDPQQY SEVMTDILGS GDDFAILWLA       240
     ESWIISASAL PTTPGYAPAT WQIDGPKSLN TNEATLTVLA PLAGRGGFVK YGEGTLLLTN       300
     SNRLMGRNEV CNGTLASTLT TDTPFGTWTV VLRNGGALAL APETSDPVAV EIASGHLARF       360
     IVDAGGGTLR LDGTNSYSVT LGGCDDGELP NIVLANDGTL AIAPGGGISA LGTSQKVLVT       420
     GTDGNLPIVT DGIVTPAILG IDTDLSGKFV TYDVTSGFIA ASPTLSTSLG INSVTVSTVY       480
     EVVDEQVIDS GAAPQLAALE LNGGTVSGSG AQLLVGNQAA GGVAGIIMNA GSIGVDTLTI       540
     GAAAAIVYAS TSDGLEISSN LSGSGGLSLF GPGTLTLSAD NSGSLSGMVN VNTGTLIAAG       600
     TSATGSGTVQ VHSAGRLEVT GSVAGPIDVA QGATLHLENG TLEGAVSIAA VGDSPMPGGI       660
     FEGAGVISGE ATIGGIVRPG PLTGILEFQA TATIAGSAMI YWRLEKLVAD VDSKPGEGWN       720
     GYLFNDASSG VGLSGDAPMY LLEFAGLGVH PDAGDPFWKQ PRRWQFMMFP NGYANIWFGD       780
     GNLYYSAGNF GLVLESDNSV YLTWTPTDPQ GPAQRRRAQI AARNRSLSRK                  830
//

If you have problems or comments...

PBIL Back to PBIL home page