(data stored in ACNUC1104 zone)

EMBL: CP002026.PE524

CP002026.PE524       Location/Qualifiers
FT   CDS             complement(553326..554093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0528"
FT                   /product="putative hydrolase protein"
FT                   /note="KEGG: rlt:Rleg2_2054 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87861"
FT                   /db_xref="GOA:D7A441"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A441"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_2054"
FT                   /protein_id="ADH87861.1"
FT                   /translation="MGLNSLISLSLAGGMLLALAAGVPAHAADPVRNVVIVHGALADGS
FT                   GWRKVHDLLVAKGYNVTVVQPPMTTLEADVAAARRILDLQEGPSVLVGHSYGGMIITEA
FT                   GNADNVASLVYIAAFQPDAGENLLDLAGRTPPATTGIKATEDGFLYLDPKVYAADFAAD
FT                   VPAAEAKFMANSQVFPSKVAFETRIKHPAWKGKKSWALIATDDRAINPELMRFMAKRAG
FT                   STPVEVKGSHAVFMSQPEAVAALIEKAAKAPAK"
     MGLNSLISLS LAGGMLLALA AGVPAHAADP VRNVVIVHGA LADGSGWRKV HDLLVAKGYN        60
     VTVVQPPMTT LEADVAAARR ILDLQEGPSV LVGHSYGGMI ITEAGNADNV ASLVYIAAFQ       120
     PDAGENLLDL AGRTPPATTG IKATEDGFLY LDPKVYAADF AADVPAAEAK FMANSQVFPS       180
     KVAFETRIKH PAWKGKKSWA LIATDDRAIN PELMRFMAKR AGSTPVEVKG SHAVFMSQPE       240
     AVAALIEKAA KAPAK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page