(data stored in ACNUC1104 zone)

EMBL: CP002026.PE525

CP002026.PE525       Location/Qualifiers
FT   CDS             complement(554305..555336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0529"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="TIGRFAM: 1-aminocyclopropane-1-carboxylate
FT                   deaminase; KEGG: smd:Smed_6456
FT                   1-aminocyclopropane-1-carboxylate deaminase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87862"
FT                   /db_xref="GOA:D7A442"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7A442"
FT                   /inference="protein motif:TFAM:TIGR01274"
FT                   /protein_id="ADH87862.1"
FT                   /translation="MSLFVSLLDKFERYPLTFGPTPIEPLPRLSAALGGKVEIYAKRDD
FT                   CNSGLAMGGNKLRKLEYIVPDAIACGADTLVSIGGVQSNHTRMVAATAAKIGMKCVVIQ
FT                   EKWVPHYDAVYDRVGNILMTRLMGADSRLIDAGFDIGIRQSWEDAIRSVEAMGGRPYPI
FT                   PAGASVHKFGGLGYVGFAEEVARQEEELGFRFDYIIVCVVTGSTQAGMIVGFAHQGRAE
FT                   RVIGIDASGTLERTRAQVRRIVDDTAELVGLGRTVREDEIVINPDYAYPAYGVPSEETN
FT                   EAIRLAARTEAMITDPVYEGKSMQGLIDLTRKGFFPDGSKVLYAHLGGVPAINGYSYYY
FT                   KDG"
     MSLFVSLLDK FERYPLTFGP TPIEPLPRLS AALGGKVEIY AKRDDCNSGL AMGGNKLRKL        60
     EYIVPDAIAC GADTLVSIGG VQSNHTRMVA ATAAKIGMKC VVIQEKWVPH YDAVYDRVGN       120
     ILMTRLMGAD SRLIDAGFDI GIRQSWEDAI RSVEAMGGRP YPIPAGASVH KFGGLGYVGF       180
     AEEVARQEEE LGFRFDYIIV CVVTGSTQAG MIVGFAHQGR AERVIGIDAS GTLERTRAQV       240
     RRIVDDTAEL VGLGRTVRED EIVINPDYAY PAYGVPSEET NEAIRLAART EAMITDPVYE       300
     GKSMQGLIDL TRKGFFPDGS KVLYAHLGGV PAINGYSYYY KDG                         343
//

If you have problems or comments...

PBIL Back to PBIL home page